DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and frpr-10

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001379889.1 Gene:frpr-10 / 186481 WormBaseID:WBGene00019019 Length:292 Species:Caenorhabditis elegans


Alignment Length:271 Identity:75/271 - (27%)
Similarity:118/271 - (43%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NLHACLF----TVS---LLVVLCTISIFCLVAVSVDRYWAILYPM---AYSRNVRTRTAIFIISM 162
            |...|.|    |||   |.::....|::..|||:|||:.|:.:|:   .:|....|.|.:|:|:.
 Worm    20 NSSVCHFFWRVTVSIFPLSLIAQAGSVWTYVAVTVDRFIAVCFPIKRRVWSTRSNTITVLFVITF 84

  Fly   163 CWVAGTIVGFLPLFGWHADVNHNQEC---------LFVEVMDYNYLVFLYFATI-ITPALLMLAF 217
            .    :.:..||.| :...::||.|.         .::|.    ||.:||...| :.|..|::  
 Worm    85 I----SAIFKLPSF-FEVRLDHNGEVEPTELRKNEFYIEF----YLFYLYVTFIQLIPWTLII-- 138

  Fly   218 YTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNL 282
              .:..:||.:||          |:.|:..|:|.     ..|...|...  .|.||..|.||   
 Worm   139 --FLNAIIIHKVR----------LAYRAQEAMVH-----NSGKLNTKRE--DAERKVTVMAT--- 181

  Fly   283 SIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCIILSH----LNSAVNPVLYAYHLKDFRA 343
             ::.:.|:||.|| ..||    :..|.|.:|.:....|.||:    :|||.|.::|......||.
 Worm   182 -VMTMIFIICNIP-PGIN----YLVDRYSNPTVYRQRIPLSNVLVCVNSASNMMIYCVFNSRFRR 240

  Fly   344 ALKNLLLKMMG 354
            |    .||::|
 Worm   241 A----ALKLLG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 35/131 (27%)
7tm_1 58..334 CDD:278431 68/249 (27%)
frpr-10NP_001379889.1 7tmA_FMRFamide_R-like <20..242 CDD:410630 72/264 (27%)
TM helix 3 32..54 CDD:410630 7/21 (33%)
TM helix 4 77..93 CDD:410630 4/19 (21%)
TM helix 5 119..142 CDD:410630 7/30 (23%)
TM helix 6 177..199 CDD:410630 10/30 (33%)
TM helix 7 210..235 CDD:410630 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.