DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and frpr-7

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_510842.2 Gene:frpr-7 / 185489 WormBaseID:WBGene00018191 Length:414 Species:Caenorhabditis elegans


Alignment Length:262 Identity:62/262 - (23%)
Similarity:111/262 - (42%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LNIPYTVFEVLVAIVSIIGNVLVIIVF-RRERKLRRRTNYYIVS--------LAMADLLVGALGI 95
            ||..:|.|.|...|:.   |:|.:.:| |:||.......||:|:        ||.|.||.....:
 Worm    32 LNGYFTAFFVFTGIIL---NLLSVSIFLRKERAGTPAIQYYLVTLTLWQTALLANAFLLYSFPNL 93

  Fly    96 PFAILASMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPM---AYSRNVRTRTAI 157
            .:..|.|.|....|:..::|.:  ....|.|::.::.:::|||.|:..|:   |..:..|.|..:
 Worm    94 WWGHLVSQGTYVYLYPYVYTFA--NTTHTGSVWIVLTLTIDRYLALCQPLKHRAIGKKRRVRRLM 156

  Fly   158 FIISMCWVAGTIVGFLPLFGWHADVNHNQECLF-------VEVMD-------YNYLVFLYFATII 208
            .::|...|..:|..|   |..|..:..:::.|.       .|:.|       |:.::.:.|.|::
 Worm   157 IVVSAMAVMFSIPRF---FEVHVILICDEDQLSCVATIDRTELFDNRLYWTIYHVILAMVFVTLL 218

  Fly   209 TPALLMLAFYTHI---YRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGA 270
             |.|::.|....|   .|..|.:.:.:..  |.||:..|..:.........|..|...::.||..
 Worm   219 -PCLILFALTLRITIALRSAIAKRKSLCA--PNSDIDTRCKSIKSSRYNSSRKDHKSNIMLVLVI 280

  Fly   271 AR 272
            |:
 Worm   281 AK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 45/193 (23%)
7tm_1 58..334 CDD:278431 56/244 (23%)
frpr-7NP_510842.2 7tmA_FMRFamide_R-like 32..344 CDD:320109 62/262 (24%)
TM helix 1 33..57 CDD:320109 8/26 (31%)
TM helix 2 67..89 CDD:320109 8/21 (38%)
TM helix 3 109..131 CDD:320109 3/23 (13%)
TM helix 4 154..170 CDD:320109 3/15 (20%)
TM helix 5 205..228 CDD:320109 6/23 (26%)
TM helix 6 270..295 CDD:320109 4/13 (31%)
TM helix 7 312..337 CDD:320109
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.