DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and srw-118

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_503811.1 Gene:srw-118 / 183443 WormBaseID:WBGene00005865 Length:378 Species:Caenorhabditis elegans


Alignment Length:368 Identity:74/368 - (20%)
Similarity:138/368 - (37%) Gaps:105/368 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLPLHAATTSKDAKDSDSPSSELNIPYTVFEVL-----VAIVSIIGNVLVIIVFRRERKLRRRTN 77
            ||.|:.|........|.....|:.:|:: |.:|     :::.||:.|::...:..|:.......|
 Worm     8 LLWLYYAGIRNSTAKSLCEFEEIFVPFS-FHILSYSSEISVSSILINIVHFFILTRKSMRTSSIN 71

  Fly    78 YYIVSLAMADLLVGALGI-------PFAILA----SMGLPRNLHACLFTVSLLVVLCTISIFC-- 129
            ..:.::|:.|:....:.|       .|...:    :.|...|.|       ||.:|...|..|  
 Worm    72 ILMAAVALFDIFTSLIEIQILFERYSFIFFSCFPETYGKVLNRH-------LLHLLKDYSRRCST 129

  Fly   130 --LVAVSVDRYWAILYPMA--YSRNVRTRTAIFIISMCWVAGTIVGFLPLF-------------G 177
              :|.:::.|...|..||:  |......:.::|:|     ||.....||:.             .
 Worm   130 WLMVFIALIRTLMIRNPMSTTYESLGNPKASLFVI-----AGICTTSLPISMFKFFEVQFEKSPS 189

  Fly   178 WH----------ADVNHNQECLFVEVMDYNYLVFLY--FATIITPAL--LMLAFYTHIYRVII-- 226
            :|          |.::|    .|::  ::.:|...|  |.:|::..:  ::|.|.|.:..:.:  
 Worm   190 YHTCAPKGTYYIATMSH----FFMK--NHGFLAKYYNLFNSIVSDIVPCILLPFVTLLLVMDLWK 248

  Fly   227 --KQVRQIVTMNPASDLSRRSSAAVVQVTTP--------GRG-GHTGTMLRVLGAARKRDVKATQ 280
              |:...|:::: .|::||..:..|..||..        |.. |.:.....|||..|        
 Worm   249 TAKKRPNIISVS-KSNISRSKTGLVFCVTITFFIVEFPYGLSIGFSWMFHNVLGLHR-------- 304

  Fly   281 NLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCIILS 323
                ||.:|...:..|.|:|.    |....|       |::||
 Worm   305 ----IVAYFGHIFSMLITLNT----CTHMIV-------CLLLS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 39/211 (18%)
7tm_1 58..334 CDD:278431 63/323 (20%)
srw-118NP_503811.1 7TM_GPCR_Srw 53..346 CDD:370978 63/322 (20%)
TM helix 2 71..93 CDD:320109 4/21 (19%)
TM helix 3 115..137 CDD:320109 7/28 (25%)
TM helix 4 162..178 CDD:320109 6/20 (30%)
TM helix 5 217..240 CDD:320109 5/22 (23%)
TM helix 6 266..291 CDD:320109 5/24 (21%)
TM helix 7 307..332 CDD:320109 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.