DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and srw-138

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_503806.3 Gene:srw-138 / 183442 WormBaseID:WBGene00005885 Length:371 Species:Caenorhabditis elegans


Alignment Length:224 Identity:51/224 - (22%)
Similarity:85/224 - (37%) Gaps:48/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AIVSIIGNVLVI-IVFRRERKLRR----------RTNYYIVSLAMADLLVGALGIPFAILASM-G 104
            ||:.|:...|.| :||..|.:|.:          .|.||.|   ::|:.....|....|.:.: |
 Worm   162 AILGILFLSLPISVVFSLEYELMKSSVPSFCNSTETTYYTV---ISDIFADNDGYYLKIFSIVNG 223

  Fly   105 LPRNLHACLFTVSLLVVLCTISIFCLVAV--SVDRYWAILYPMAYSRNVR-TRTAIFIISMCWVA 166
            |..|:..|        ||.....|.||..  ..|:....|...|.:.:.| |...:|.||:.:  
 Worm   224 LVSNIIPC--------VLFPAVTFLLVVELWKSDKKRKNLSSTANANDSRKTTRLVFYISLTF-- 278

  Fly   167 GTIVGFLPLFGWHADVNHNQECLFVEV------MDYNYLVFLYFATIITPALLMLAFY-THIYRV 224
              .:...||     .:.......|::|      |.|.:..|....:..|....::.|: :..||:
 Worm   279 --FIAEFPL-----GITTGATWFFLDVPGMKTIMSYFFFNFSMLLSANTATHCIVCFFMSSQYRI 336

  Fly   225 IIKQVRQIVTMNPASDLSRRSSAAVVQVT 253
            ..|||..      ....::::.|.|::||
 Worm   337 AAKQVVS------CGYWTQKNKATVIRVT 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 42/189 (22%)
7tm_1 58..334 CDD:278431 48/218 (22%)
srw-138NP_503806.3 7TM_GPCR_Srw 39..345 CDD:370978 47/208 (23%)
TM helix 1 39..60 CDD:320109
TM helix 2 69..91 CDD:320109
TM helix 3 112..136 CDD:320109
TM helix 4 161..177 CDD:320109 5/14 (36%)
TM helix 5 216..239 CDD:320109 7/30 (23%)
TM helix 6 265..290 CDD:320109 7/33 (21%)
TM helix 7 308..331 CDD:320109 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.