DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and srw-124

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_503810.2 Gene:srw-124 / 183440 WormBaseID:WBGene00005871 Length:368 Species:Caenorhabditis elegans


Alignment Length:275 Identity:50/275 - (18%)
Similarity:106/275 - (38%) Gaps:62/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGI-----PFAILASMGL 105
            |:|  |:|:||:.|:|.:.:..|:.......|..:.::|:.|:....:.|     .::.|.....
 Worm    42 VYE--VSILSILINILHLFILTRKSMRTSSINILMAAVALFDIFASLVHIQLFLEQYSYLIFKCF 104

  Fly   106 PRNLHACLFTVSLLVVLCTISIFC----LVAVSVDRYWAILYPMAYSRNV--RTRTAIFIISMCW 164
            |.:.:..:.|.:||:|:...|..|    :|.:::.|...|..|::....:  :.:.::.:|:...
 Worm   105 PTDTYGLVLTRTLLIVVKDFSRRCSTWLIVFIALIRTLIIRNPLSPKHILLGKPKASLIVIAGIC 169

  Fly   165 VAGTIVGFLPLFGWHADVNHNQECLFVEVMDY------NYLVFLYFATIITPALLM-----LAFY 218
            .|...:.....|        ..:.:||.:..:      :|    ||  |.:..|.:     ||.|
 Worm   170 AANLPISIFKFF--------EIQFVFVTISKHHCAPEGSY----YF--IASSELFLRDNGFLAKY 220

  Fly   219 THIYRVIIKQ-----VRQIVTMNPASDL--SRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDV 276
            .:.:...:..     :..|||.....||  :|:...|.:........|.||.:            
 Worm   221 FNFFNSFMSDMIPCILLPIVTCLLVMDLLKTRKKCRARISAKNNNSRGKTGLV------------ 273

  Fly   277 KATQNLSIIVLFFMI 291
                 ..:.::||::
 Worm   274 -----FCVAIMFFIV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 35/189 (19%)
7tm_1 58..334 CDD:278431 44/263 (17%)
srw-124NP_503810.2 7TM_GPCR_Srw 41..347 CDD:370978 50/275 (18%)
TM helix 2 71..93 CDD:320109 4/21 (19%)
TM helix 3 116..138 CDD:320109 6/21 (29%)
TM helix 4 163..179 CDD:320109 2/15 (13%)
TM helix 5 219..242 CDD:320109 3/22 (14%)
TM helix 6 267..293 CDD:320109 5/34 (15%)
TM helix 7 308..333 CDD:320109
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.