DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and frpr-3

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_505004.1 Gene:frpr-3 / 182942 WormBaseID:WBGene00016149 Length:360 Species:Caenorhabditis elegans


Alignment Length:404 Identity:87/404 - (21%)
Similarity:154/404 - (38%) Gaps:90/404 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGL----PRNL 109
            ||:....|:.|.:...::.|:...::..|..:.:|:|:||.|..|.||  :.||..|    |..:
 Worm    14 VLMCFGGILTNFISFYIYTRKTFRKKSINVLLAALSMSDLCVCVLAIP--VFASTQLQQVIPPTI 76

  Fly   110 HACL--FTVSLLVVLCTISIFCLVAVSVDRYWAILYP-MAYSRNVRTRTAIFIISMCWVAGTIVG 171
            .|.:  :...:.::..::|::.||::::|||.|:.:| |..:...|.|..|.:       |.:|.
 Worm    77 TAMIMVYLYPVTIMFQSVSVWLLVSITIDRYLAVCHPFMVNTYCTRNRALITV-------GVVVI 134

  Fly   172 FLPLFG----WH-------ADVNHNQECLFVEVMDYNYLVFLYFATIITPALLMLAFYTHIYRVI 225
            |...:.    |.       |..|...|.|.|..:..|....|::..:.| .:...||...:..|:
 Worm   135 FSVAYNLIRIWEYTINFDVAPENRTIEDLVVPKLRANPHFLLWYQNVAT-LVSQFAFPLTVLCVL 198

  Fly   226 IKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFM 290
            ..||.:  |:..||:..|...|:|                       ||:....:.:.::||.|:
 Worm   199 NIQVAR--TIIEASEQRRELVASV-----------------------KREHSTAKMMIMVVLVFL 238

  Fly   291 ICWIPLYTINC------------IKAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRA 343
            :|:|..:.:|.            |..|..|         ...:|..:||....|.|..:...||.
 Worm   239 VCYIFSFILNIWEILDKETFGGDIGWFMND---------INNVLIVVNSTSAIVFYYKYSTRFRN 294

  Fly   344 ALKNLLLKMMGVDIDQQAEAIHRFSVASQHRLQSMDSNMRSTQPRLYVGEYSPIWLRQQQEALKN 408
            ..:.|             ..|..::..|:..:...::....|....|  :.|.|.:|.....|.:
 Worm   295 QARTL-------------PGIRWYASMSKFNVYDTEATSNRTMVTRY--KESMISIRGTSTRLSS 344

  Fly   409 S-QLLPKCGVVSPC 421
            | .||.|.....||
 Worm   345 SHNLLYKPSYSKPC 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 43/185 (23%)
7tm_1 58..334 CDD:278431 66/305 (22%)
frpr-3NP_505004.1 7tmA_FMRFamide_R-like 12..294 CDD:320109 71/323 (22%)
TM helix 1 12..34 CDD:320109 4/19 (21%)
TM helix 2 41..66 CDD:320109 10/26 (38%)
TM helix 3 81..111 CDD:320109 7/29 (24%)
TM helix 4 123..143 CDD:320109 5/26 (19%)
TM helix 5 176..201 CDD:320109 5/25 (20%)
TM helix 6 221..251 CDD:320109 8/29 (28%)
TM helix 7 264..289 CDD:320109 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.