DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and Mtnr1a

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_032665.1 Gene:Mtnr1a / 17773 MGIID:102967 Length:353 Species:Mus musculus


Alignment Length:335 Identity:76/335 - (22%)
Similarity:149/335 - (44%) Gaps:57/335 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRN---LH 110
            :...:|.|:||:|||:...|.:|||...|.::||||:|||:|.....|..:.:.:....|   ||
Mouse    38 IFTIVVDILGNLLVILSVYRNKKLRNSGNIFVVSLAVADLVVAVYPYPLVLTSILNNGWNLGYLH 102

  Fly   111 ACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPL 175
             |..:..|:.:....|||.:..::::||..|.:.:.|.:....:.::..:.:.|:. |::..:| 
Mouse   103 -CQVSAFLMGLSVIGSIFNITGIAMNRYCYICHSLKYDKIYSNKNSLCYVFLIWML-TLIAIMP- 164

  Fly   176 FGWHADVNHNQ------ECLFVEVMDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVT 234
               :......|      .|.|.:.:...|.:.:.....|.|.::::..|..|: |::.|||:.|.
Mouse   165 ---NLQTGTLQYDPRIYSCTFTQSVSSAYTIAVVVFHFIVPMIIVIFCYLRIW-VLVLQVRRRVK 225

  Fly   235 MNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTI 299
            .:....|                              :.:|.:....:.::.:.|.|||.||..|
Mouse   226 PDNKPKL------------------------------KPQDFRNFVTMFVVFVLFAICWAPLNLI 260

  Fly   300 NCIKAFCPDCYVHPKLTLFCII----LSHLNSAVNPVLYAYHLKDFRAALKNLLL-----KMMGV 355
            ..|.|..|...| |::..:..:    |::.||.:|.::|....::||...|.:::     ||..|
Mouse   261 GLIVASDPATMV-PRIPEWLFVASYYLAYFNSCLNAIIYGLLNQNFRKEYKKIIVSLCTAKMFFV 324

  Fly   356 D-IDQQAEAI 364
            : .:::|:.|
Mouse   325 ESSNEEADKI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 43/176 (24%)
7tm_1 58..334 CDD:278431 65/288 (23%)
Mtnr1aNP_032665.1 7tm_4 38..>160 CDD:304433 35/123 (28%)
7tm_1 47..298 CDD:278431 65/288 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.