DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and ADRA1D

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_000669.1 Gene:ADRA1D / 146 HGNCID:280 Length:572 Species:Homo sapiens


Alignment Length:492 Identity:121/492 - (24%)
Similarity:191/492 - (38%) Gaps:112/492 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFA----ILASMGLP 106
            ||.....::::.||:|||:.....|.|:..|||:||:||:||||:.|..:||:    :|......
Human   101 VFLAAFILMAVAGNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFG 165

  Fly   107 RNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVG 171
            |..  |....::.|:.||.||..|..:|||||..:.:.:.|...:..|.|..|:::.||...:|.
Human   166 RAF--CDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVS 228

  Fly   172 FLPLFGWHADVNHNQE-CLFVEVMDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTM 235
            ..||.||...|..::. |...|  :..|.||....:...|..:::..|..:|.|.....|.:   
Human   229 VGPLLGWKEPVPPDERFCGITE--EAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSL--- 288

  Fly   236 NPASDLSRRSSAAVVQVTTPGRGGHTGT------------------MLRVLGAARKRDVKATQNL 282
             .|.....|..|:.|.:....||..||.                  .:|:|..:|::  ||.:.|
Human   289 -EAGVKRERGKASEVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREK--KAAKTL 350

  Fly   283 SIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCII--LSHLNSAVNPVLYAYHLKDFRAAL 345
            :|:|..|::||.|.:.:..:.:..|.  :.|...:|.:|  |.:.||.|||::|....::|:.|.
Human   351 AIVVGVFVLCWFPFFFVLPLGSLFPQ--LKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAF 413

  Fly   346 KNLLLKMMGVDIDQQAEAIHRFSVASQHRLQSMDSNMRSTQPRLYVGEYSPIWLRQQQEALKNSQ 410
            ..||                        |.|......|....|:| |.:   | |.....|: ..
Human   414 LRLL------------------------RCQCRRRRRRRPLWRVY-GHH---W-RASTSGLR-QD 448

  Fly   411 LLPKCGVVSPCFNNINQTVAAVASVTTDLEREMWNIVEASSGAELGETSYEFPSP-APGSQRSSE 474
            ..|..|                               :|..||.|..|:...|.| .||:.....
Human   449 CAPSSG-------------------------------DAPPGAPLALTALPDPDPEPPGTPEMQA 482

  Fly   475 RNSSSTVPPA-------------PPAPAKPSVPSASY 498
            ..:|...||:             |....:..|.|.|:
Human   483 PVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSH 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 54/172 (31%)
7tm_1 58..334 CDD:278431 87/300 (29%)
ADRA1DNP_000669.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
7tmA_alpha1D_AR 97..413 CDD:320450 91/323 (28%)
TM helix 1 98..124 CDD:320450 7/22 (32%)
TM helix 2 131..157 CDD:320450 14/25 (56%)
TM helix 3 169..199 CDD:320450 12/29 (41%)
TM helix 4 211..234 CDD:320450 8/22 (36%)
TM helix 5 251..280 CDD:320450 6/28 (21%)
TM helix 6 341..371 CDD:320450 10/31 (32%)
TM helix 7 381..406 CDD:320450 9/24 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..488 13/75 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.