DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and TAAR1

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_612200.1 Gene:TAAR1 / 134864 HGNCID:17734 Length:339 Species:Homo sapiens


Alignment Length:327 Identity:81/327 - (24%)
Similarity:145/327 - (44%) Gaps:64/327 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNLHA-- 111
            ||:.:.:::||::||:.....::|...||:.|.|:|..|.|:|.|.:|::::.|..     |.  
Human    31 VLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAE-----HCWY 90

  Fly   112 -----CLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVG 171
                 |....|..::|.:.|||.|..:|:|||:|:..|:.|...:.......:|.:.|....:..
Human    91 FGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFA 155

  Fly   172 FLPLFGWHADVNHNQECLFVEVMDYNYL---------------VFLYFATIITPALLMLAFYTHI 221
            |..:|   .::|...    .|.:.|.::               |..:..:...|..:||..|..|
Human   156 FGMIF---LELNFKG----AEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRI 213

  Fly   222 YRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIV 286
            |.:..:|.|.|      ||.:::     :|:....:.          |.::.::.||.:.|.|::
Human   214 YLIAKEQARLI------SDANQK-----LQIGLEMKN----------GISQSKERKAVKTLGIVM 257

  Fly   287 LFFMICWIPLYTINCIKAFCPDCYVH----PKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALKN 347
            ..|:|||.|.:....:     |.::|    |.|....|...:|||..||::||:....||.|||.
Human   258 GVFLICWCPFFICTVM-----DPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKM 317

  Fly   348 LL 349
            :|
Human   318 ML 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 43/189 (23%)
7tm_1 58..334 CDD:278431 71/301 (24%)
TAAR1NP_612200.1 7tm_4 38..319 CDD:304433 78/318 (25%)
7tm_1 40..304 CDD:278431 71/301 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.