DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and ADORA1

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_000665.1 Gene:ADORA1 / 134 HGNCID:262 Length:326 Species:Homo sapiens


Alignment Length:322 Identity:111/322 - (34%)
Similarity:174/322 - (54%) Gaps:43/322 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PS-SELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAI 99
            || |.....|...|||:|:||:.||||||...:..:.||..|..:|||||:||:.||||.||.||
Human     3 PSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAI 67

  Fly   100 LASMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCW 164
            |.::|.....|.||.....:::|...||..|:|::||||..:..|:.|...|..|.|...|:.||
Human    68 LINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCW 132

  Fly   165 VAGTIVGFLPLFGWH----------ADVNHNQ---ECLFVEVMDYNYLV-FLYFATIITPALLML 215
            :...:||..|:|||:          |:.:..:   :|.|.:|:...|:| |.:|..::.|.|||:
Human   133 ILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMV 197

  Fly   216 AFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQ 280
            ..|..::.:|.||            |:::.||:            :|...:..|    :::|..:
Human   198 LIYLEVFYLIRKQ------------LNKKVSAS------------SGDPQKYYG----KELKIAK 234

  Fly   281 NLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFR 342
            :|::|:..|.:.|:||:.:|||..|||.|:....||...|.|:|.|||:||::||:.::.||
Human   235 SLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 68/181 (38%)
7tm_1 58..334 CDD:278431 97/289 (34%)
ADORA1NP_000665.1 7tm_4 18..>137 CDD:304433 50/118 (42%)
7tm_1 26..288 CDD:278431 97/289 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150902
Domainoid 1 1.000 181 1.000 Domainoid score I3483
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6485
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000536
OrthoInspector 1 1.000 - - otm40873
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24246
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X919
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.