DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and AgaP_AGAP004930

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_315017.4 Gene:AgaP_AGAP004930 / 1275731 VectorBaseID:AGAP004930 Length:330 Species:Anopheles gambiae


Alignment Length:327 Identity:78/327 - (23%)
Similarity:139/327 - (42%) Gaps:38/327 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRR----TNYYIVSLAMADLLVGALGIPF 97
            |||::|........:|::..||||..::...|.|.:|:|    |..:::|||.||||.....:|.
Mosquito    21 SSEISIVAASSATFIAVLGTIGNVTTLLALGRNRAVRQRRRQPTTAFVMSLATADLLFCVAVMPL 85

  Fly    98 AILASMGLPR------NLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTA 156
            ..| ..|..|      :|...||.|:|...:.| |:..|||::|:||..|::|..|....||...
Mosquito    86 MAL-RYGRRRWPFVSDSLWCRLFPVALYGTVAT-SVLSLVALTVNRYVLIVHPAWYGAVYRTAGM 148

  Fly   157 IFI-ISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVM---------DYNYLVFLYFATIITPA 211
            :.: :::||.....:..||||.....:..::......|:         ..:...|::......|.
Mosquito   149 VPLQLAICWAIPYGLMALPLFELWGRLGFDRRTFSCTVLPSITSTGKFSASPKKFIFIVGFALPF 213

  Fly   212 LLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDV 276
            ..::..||.|...:.:|.|.:      ...:.:..||....:|||         .:...:...|.
Mosquito   214 CAIVLCYTAIIGAVRRQRRHM------QRYAAKPVAATSVASTPG---------SIAAPSNDDDE 263

  Fly   277 K-ATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKD 340
            : .|:..:.|...||:|::||...|.:............:.:...||:..::.:||.:||...:.
Mosquito   264 RHLTRTTAAIFGCFMLCFLPLTIANVLLEDAESVGEAGDVHVLASILTWHSAVLNPFIYALGSRH 328

  Fly   341 FR 342
            :|
Mosquito   329 YR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 49/187 (26%)
7tm_1 58..334 CDD:278431 69/296 (23%)
AgaP_AGAP004930XP_315017.4 7tm_1 63..322 CDD:278431 62/275 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.