DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and GPRNPR2

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_314808.3 Gene:GPRNPR2 / 1275552 VectorBaseID:AGAP008702 Length:268 Species:Anopheles gambiae


Alignment Length:245 Identity:53/245 - (21%)
Similarity:96/245 - (39%) Gaps:55/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 IISMCWVAGTIVGFLPLFGWHADVNHNQE-------CLFVEVMDYNYLVF--LYFATI-ITPALL 213
            :|...|:...:.. :|.|.:...:.:|..       |:....| :|..:|  :.||.: :.|.|:
Mosquito     8 VIVAVWITSAVYS-IPKFIFVRTITNNLSDDQLETICIVNRKM-FNSELFDIINFALLYLLPLLV 70

  Fly   214 ML--AFYTHIYRVIIKQ----VRQIVTMN-------------PASDLSRRS-------------S 246
            |.  ..|:.|...:.|.    .|.|...|             |:|...:|:             |
Mosquito    71 MTVSVLYSRIAIALWKSSRGLERHIALQNTTSSSYSSNFHRKPSSKYDKRTTGVTESQVSVSVES 135

  Fly   247 AAVVQVTTPGRGG---HTGTMLRVLGAARKRDVKATQN----LSIIVLFFMICWIPLYTINCIKA 304
            ..||..|.|.:..   ..||.|..:..:....::|.:.    |.::||.|.:|.:|.:.....:.
Mosquito   136 DKVVVTTWPAQNSFHQRHGTQLTQVSHSSNNVLRARRGVIRMLMVVVLTFALCNLPFHARKMWQY 200

  Fly   305 FCP----DCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALKNLLL 350
            :..    |...:...|....::::.||.|||:|||:..::||..::.|||
Mosquito   201 WSTDYKGDSNFNALFTPLTFLVTYFNSGVNPLLYAFLSRNFRKGMRELLL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 15/72 (21%)
7tm_1 58..334 CDD:278431 45/227 (20%)
GPRNPR2XP_314808.3 7tm_1 <159..234 CDD:278431 14/74 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.