DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and CNR2

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001832.1 Gene:CNR2 / 1269 HGNCID:2160 Length:360 Species:Homo sapiens


Alignment Length:375 Identity:91/375 - (24%)
Similarity:154/375 - (41%) Gaps:89/375 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ATTSKDAKDSDSPSSELNI-------PYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNY-YI 80
            |..|||..|| :|..:..|       ...|...|:.::|.:.||.|:.:.....:|||:.:| :|
Human    10 ANGSKDGLDS-NPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFI 73

  Fly    81 VSLAMADLLVGALGIPFAILASMGLPRNLH---------ACLFTVSLLVVLCTISIFCLVAVSVD 136
            .|||.||.|.   .:.||....     |.|         ..|..:..:.:..|.|:..|:..::|
Human    74 GSLAGADFLA---SVVFACSFV-----NFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAID 130

  Fly   137 RYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVMDY--NYL 199
            ||..:.||.:|...:....|:..:.:.||...:|.:|||.||........|...:...||  ::|
Human   131 RYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWL 195

  Fly   200 VFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTM 264
            :|:.|       |.....||:.: |:.|..:.:.:::                      ||... 
Human   196 LFIAF-------LFSGIIYTYGH-VLWKAHQHVASLS----------------------GHQDR- 229

  Fly   265 LRVLGAARKR-DVKATQNLSIIVLFFMICWIPLYTI-----------NCIKAFCPDCYVHPKLTL 317
             :|.|.||.| ||:..:.|.:::...:|||.|:..:           ...|||.           
Human   230 -QVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFA----------- 282

  Fly   318 FCIILSHLNSAVNPVLYAYHLKDFRAALKNLL------LKMMGVDIDQQA 361
            ||.:|..:||.||||:||....:.|::..:.|      ::.:|.:..::|
Human   283 FCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 46/179 (26%)
7tm_1 58..334 CDD:278431 74/299 (25%)
CNR2NP_001832.1 7tmA_CB2 34..310 CDD:320463 80/326 (25%)
TM helix 1 36..60 CDD:320463 6/23 (26%)
TM helix 2 70..91 CDD:320463 10/23 (43%)
TM helix 3 107..129 CDD:320463 4/21 (19%)
TM helix 4 152..168 CDD:320463 3/15 (20%)
TM helix 5 187..210 CDD:320463 8/29 (28%)
TM helix 6 244..266 CDD:320463 5/21 (24%)
TM helix 7 278..303 CDD:320463 14/35 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..360 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.