DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and GPR139

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001002911.1 Gene:GPR139 / 124274 HGNCID:19995 Length:353 Species:Homo sapiens


Alignment Length:401 Identity:82/401 - (20%)
Similarity:155/401 - (38%) Gaps:113/401 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HAATTSKDAKDSDSPSSELNIPY--TVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNY-YIVSL 83
            ||...:..:....||.|...:.:  .|:..|:..:.:..|:|.:|:..:....|::::| |:::|
Human     5 HAHLAANSSLSWWSPGSACGLGFVPVVYYSLLLCLGLPANILTVIILSQLVARRQKSSYNYLLAL 69

  Fly    84 AMADLLVGALGIPFA------ILASMGLPR------------NLHACLFTVSLLVVLCTISIFCL 130
            |.||:|| ...|.|.      .:.:|.:|:            ::|.              ||:..
Human    70 AAADILV-LFFIVFVDFLLEDFILNMQMPQVPDKIIEVLEFSSIHT--------------SIWIT 119

  Fly   131 VAVSVDRYWAILYPMAY---SRNVRTRTAIFIISM-CWVAGTIVGFLPLFGWHADVNHNQECLFV 191
            |.:::|||.|:.:|:.|   |...|||..|..:.: |::..     :|.:.|......:    ::
Human   120 VPLTIDRYIAVCHPLKYHTVSYPARTRKVIVSVYITCFLTS-----IPYYWWPNIWTED----YI 175

  Fly   192 EVMDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPG 256
            ....::.|::::..|:.   |:..:.:..:..:|:.::|            |:|:..:       
Human   176 STSVHHVLIWIHCFTVY---LVPCSIFFILNSIIVYKLR------------RKSNFRL------- 218

  Fly   257 RGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIP-----LYTINCIKAFCPDCYVHPKLT 316
            ||..||              |.|..|..|...|...|.|     ||.:          |..|...
Human   219 RGYSTG--------------KTTAILFTITSIFATLWAPRIIMILYHL----------YGAPIQN 259

  Fly   317 LFCI--------ILSHLNSAVNPVLYAYHLKDFR---AALKNLLLKMMGVDIDQQAEAIHRFSVA 370
            .:.:        :|:.||:|:|..||.:..|.||   ||......|.....:  |....|.||:.
Human   260 RWLVHIMSDIANMLALLNTAINFFLYCFISKRFRTMAAATLKAFFKCQKQPV--QFYTNHNFSIT 322

  Fly   371 SQHRLQSMDSN 381
            |...:...:|:
Human   323 SSPWISPANSH 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 37/190 (19%)
7tm_1 58..334 CDD:278431 61/311 (20%)
GPR139NP_001002911.1 7tmA_GPR139 27..296 CDD:320585 68/338 (20%)
TM helix 1 29..53 CDD:320585 5/23 (22%)
TM helix 2 63..85 CDD:320585 10/22 (45%)
TM helix 3 102..124 CDD:320585 4/35 (11%)
TM helix 4 147..163 CDD:320585 2/20 (10%)
TM helix 5 181..204 CDD:320585 3/25 (12%)
TM helix 6 227..249 CDD:320585 6/21 (29%)
TM helix 7 264..289 CDD:320585 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.