DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and CCR8

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_005192.1 Gene:CCR8 / 1237 HGNCID:1609 Length:355 Species:Homo sapiens


Alignment Length:383 Identity:84/383 - (21%)
Similarity:150/383 - (39%) Gaps:119/383 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNLH 110
            ||..|:.:.|::||.|||:|....:|||..|:.|:::||::|||. ....||.            
Human    40 VFYCLLFVFSLLGNSLVILVLVVCKKLRSITDVYLLNLALSDLLF-VFSFPFQ------------ 91

  Fly   111 ACLFTVSLL------VVLCTI-----------SIFCLVAVSVDRYWAILYPMAYSRNVRT-RTAI 157
                |..||      .|:|.:           |:|.:..:|||||.|:::.: |:..||| |...
Human    92 ----TYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAV-YALKVRTIRMGT 151

  Fly   158 FIISMCWVAGTIVGFLPLFGWHADVN----------HNQECLFVEVMDYNYLVFLYFATIITPAL 212
            .:....|:. .|:..:||..::...:          :||:.|       .:.:|..|...|...|
Human   152 TLCLAVWLT-AIMATIPLLVFYQVASEDGVLQCYSFYNQQTL-------KWKIFTNFKMNILGLL 208

  Fly   213 LMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVK 277
            :....:...|..|:.|:::....|                                      ..|
Human   209 IPFTIFMFCYIKILHQLKRCQNHN--------------------------------------KTK 235

  Fly   278 ATQNLSIIVLFFMICWIP---------LYTINCIKAFCPDCYVHPKLTL---FCIILSHLNSAVN 330
            |.:.:.|:|:..::.|:|         |::::.:..    |.:..:||.   ...|:|..:..||
Human   236 AIRLVLIVVIASLLFWVPFNVVLFLTSLHSMHILDG----CSISQQLTYATHVTEIISFTHCCVN 296

  Fly   331 PVLYAYHLKDFRAALKNLLLK-------MMGVDIDQQAEAIHRFSVASQH--RLQSMD 379
            ||:||:..:.|:..|..:..|       .:|..:.:  |:..:.|...||  |..|:|
Human   297 PVIYAFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPR--ESCEKSSSCQQHSSRSSSVD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 48/195 (25%)
7tm_1 58..334 CDD:278431 67/315 (21%)
CCR8NP_005192.1 PHA03087 1..313 CDD:222976 75/340 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.