DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and OR2D2

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_003691.1 Gene:OR2D2 / 120776 HGNCID:8244 Length:308 Species:Homo sapiens


Alignment Length:340 Identity:74/340 - (21%)
Similarity:140/340 - (41%) Gaps:79/340 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SDSPSSELNIPYTVFEVL--VAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGI 95
            ||.|.:|    ..:|.||  |.:|:::||:|:|.:...:.:|.....:::.:|::|||......:
Human    18 SDGPHTE----QLLFIVLLGVYLVTVLGNLLLISLVHVDSQLHTPMYFFLCNLSLADLCFSTNIV 78

  Fly    96 PFAILASMGLPRNLHACLFTVSLLVVL---CTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAI 157
            |.|::..:...:.:...|....||..|   || ....|..:|.|||.||..|:.|...:..:..:
Human    79 PQALVHLLSRKKVIAFTLCAARLLFFLIFGCT-QCALLAVMSYDRYVAICNPLRYPNIMTWKVCV 142

  Fly   158 FIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVMDYNYLVFL----------YFATIITPAL 212
            .:.:..|.:|                     :.|.|:|..:::.|          :|..  .|||
Human   143 QLATGSWTSG---------------------ILVSVVDTTFILRLPYRGSNSIAHFFCE--APAL 184

  Fly   213 LMLAFY-THIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDV 276
            |:||.. ||...:.|..:..::.:.|...:.......:|.|.         .|...:|:. |...
Human   185 LILASTDTHASEMAIFLMGVVILLIPVFLILVSYGRIIVTVV---------KMKSTVGSL-KAFS 239

  Fly   277 KATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPK--------LTLFCIILSHLNSAVNPVL 333
            ....:|.:::||:....|              .|:.||        :::|..|::.:   :||::
Human   240 TCGSHLMVVILFYGSAII--------------TYMTPKSSKQQEKSVSVFYAIVTPM---LNPLI 287

  Fly   334 YAYHLKDFRAALKNL 348
            |:...||.:|||:.:
Human   288 YSLRNKDVKAALRKV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 40/181 (22%)
7tm_1 58..334 CDD:278431 59/297 (20%)
OR2D2NP_003691.1 7tm_4 34..302 CDD:304433 67/318 (21%)
7tm_1 41..288 CDD:278431 59/297 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.