DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and NPY4R2

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001265724.1 Gene:NPY4R2 / 100996758 HGNCID:52383 Length:375 Species:Homo sapiens


Alignment Length:425 Identity:99/425 - (23%)
Similarity:169/425 - (39%) Gaps:104/425 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLPLHAATTSKDAKDSDSPSSELNIPYTVFE-------VLV---------AIVSIIGNVLVIIVF 66
            |||        .:...::.|..|..||...|       |:|         .:|.::||:.::.|.
Human    10 LLP--------KSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVT 66

  Fly    67 RRERKLRRRTNYYIVSLAMADLLVGALGIP----FAILASMGLPRNLHACLFTVSLLVVLCTISI 127
            .|:::....||..|.:||.:|.|:..|..|    :.|:........|  |..:..:..:..|:||
Human    67 VRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETL--CKMSAFIQCMSVTVSI 129

  Fly   128 FCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFG-------WHADVNHN 185
            ..||.|:::|:..|:.|..:..::  ..|...|.:.||...::. ||...       :|.  ||:
Human   130 LSLVLVALERHQLIINPTGWKPSI--SQAYLGIVLIWVIACVLS-LPFLANSILENVFHK--NHS 189

  Fly   186 Q--ECLFVEVMDYNYLVFLYFATIITPALLM----------LAFYTHIYRVIIKQVRQIVTMNPA 238
            :  |.|..:|:........:..||.|..||:          |..|..|||.:.:|          
Human   190 KALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRRLQRQ---------- 244

  Fly   239 SDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIK 303
                             ||..|.||.  .|.|...:.|...  |.::|:.|.:.|:||:..|.::
Human   245 -----------------GRVFHKGTY--SLRAGHMKQVNVV--LVVMVVAFAVLWLPLHVFNSLE 288

  Fly   304 AF----CPDCYVHPKLT-LFCIILSHLNSAVNPVLYAYHLKDFRAALKNLLLKMMGVDIDQQAEA 363
            .:    .|.|  |..|. |.|.:|:..::.|||.:|.:...:|:..:|.|:|..      ||:..
Human   289 DWHHEAIPIC--HGNLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTC------QQSAP 345

  Fly   364 IHRFSVASQH-RLQSMDSNMRSTQPRLYVGEYSPI 397
            :..    |:| .|.::.:.:.....|| .|..:||
Human   346 LEE----SEHLPLSTVHTEVSKGSLRL-SGRSNPI 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 45/190 (24%)
7tm_1 58..334 CDD:278431 73/303 (24%)
NPY4R2NP_001265724.1 7tmA_NPY4R 42..333 CDD:320519 77/330 (23%)
TM helix 1 43..69 CDD:320519 4/25 (16%)
TM helix 2 76..101 CDD:320519 9/24 (38%)
TM helix 3 114..144 CDD:320519 8/29 (28%)
TM helix 4 155..176 CDD:320519 6/21 (29%)
TM helix 5 211..240 CDD:320519 9/28 (32%)
TM helix 6 258..288 CDD:320519 8/31 (26%)
TM helix 7 301..326 CDD:320519 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.