DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and or80a13

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001243283.1 Gene:or80a13 / 100861460 ZFINID:ZDB-GENE-070804-2 Length:319 Species:Danio rerio


Alignment Length:328 Identity:66/328 - (20%)
Similarity:125/328 - (38%) Gaps:78/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNLHACL 113
            ::..|:.::||.:.:.|....|.|.:.....|.:||:.|::       ::...|..:...|.|.:
Zfish    31 LITYILVLLGNGINLCVISTNRHLHKPMYILICNLAVVDVM-------YSSTCSTTMISVLLADV 88

  Fly   114 FTVSLLVVLCTISIF---------CLVAVSVDRYWAILYPMAYSRNV-RTRTAIFIISMCWV-AG 167
            .|||....:..:..:         .|..:::||..||..|:.|...| .:||.:||: :.|| |.
Zfish    89 KTVSYYSCISRMFFYHIGDFTECMALTLMAIDRLIAIRLPLRYHSIVTNSRTFLFIV-LTWVIAI 152

  Fly   168 TIVGFLPLFGWHADVNHNQECLFVEVMDYNYLVFLYFATII------------TPALLMLAFYTH 220
            .::|.|.     :.|::...|  ..|:.|   ||..:.::|            .||::.|.::..
Zfish   153 ALMGVLT-----SAVDNAPYC--QPVIKY---VFCDYPSMIRAACVNPEPYFFLPAMINLWWFCG 207

  Fly   221 IYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSII 285
            ::..::  ....|.....:.||..||                         ||:.:....:..::
Zfish   208 LFPFVM--CTYAVLAYSVTKLSNNSS-------------------------RKQMINTCLSHLVV 245

  Fly   286 VLFFMICWIPLYTINCIKAFCPDCYVHPKLT---LFCIILSHLNSAVNPVLYAYHLKDFRAALKN 347
            :|.:       |....:.|......|...||   ...||.|.:...:||.:|....|:.|..|.:
Zfish   246 LLSY-------YAPKIVSALLTRIGVVLTLTERNAILIISSLIPPLINPTVYCTRTKEIRKRLAD 303

  Fly   348 LLL 350
            :.|
Zfish   304 VFL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 43/190 (23%)
7tm_1 58..334 CDD:278431 60/301 (20%)
or80a13NP_001243283.1 7tm_4 34..308 CDD:304433 66/325 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24246
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.