DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and gpr6

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_003200829.1 Gene:gpr6 / 100538060 -ID:- Length:333 Species:Danio rerio


Alignment Length:339 Identity:85/339 - (25%)
Similarity:133/339 - (39%) Gaps:56/339 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LHAATTSKD---AKDSDSPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVS 82
            |.|.|.:.:   |..|.||:..:| |:.:...|...|....|.:|:.:......||......|.|
Zfish    21 LEAETFASNGTLALSSASPNFHVN-PWDIMLCLSGTVIACENAIVVAIIFYTPTLRNPMFVLIGS 84

  Fly    83 LAMADLLVG---ALGIPFAILASMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYP 144
            ||.||||.|   .|...|..|.|     :....|.||..||...|.||..|:|::||||.::...
Zfish    85 LATADLLAGMGLILNFAFQYLVS-----SETISLITVGFLVASFTASISSLLAITVDRYLSLYNA 144

  Fly   145 MAYSRNVRTRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECLFVEVMDYNYLVFL---YFAT 206
            :.|...........::...|.|...:|.||:.||:. ::....|..|..:..:.|..|   :|..
Zfish   145 LTYFSEKTLHYVHLMLVGTWGASLCLGLLPVLGWNC-LDDASTCSIVRPLKRSNLTLLATSFFII 208

  Fly   207 IITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAA 271
            .|    |||:.|..|.:::.:...||....                       |..|....:...
Zfish   209 FI----LMLSLYFKICKIVCRHAHQIALQQ-----------------------HFFTTSHYVATK 246

  Fly   272 RKRDVKATQNLSIIVLFFMICWIPLYTINCI--KAFCPDCYVHPKLTLFCIILSHLNSAVNPVLY 334
                 |....|:||:..|...|:| :.|.|:  :...|..|.:..|     :.:..||.:||::|
Zfish   247 -----KGVSTLAIILGTFGASWLP-FAIYCLVGEREYPPVYTYATL-----LPATYNSMINPIIY 300

  Fly   335 AYHLKDFRAALKNL 348
            ||...:.:.::..|
Zfish   301 AYRNTEIQRSIHML 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 50/173 (29%)
7tm_1 58..334 CDD:278431 70/283 (25%)
gpr6XP_003200829.1 7tm_4 50..316 CDD:304433 76/309 (25%)
7tm_1 60..300 CDD:278431 70/283 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.