DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and mlnr

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_003200046.1 Gene:mlnr / 100536406 ZFINID:ZDB-GENE-130530-1015 Length:345 Species:Danio rerio


Alignment Length:349 Identity:76/349 - (21%)
Similarity:143/349 - (40%) Gaps:76/349 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAIL 100
            |:|.| ||.|...:.:.|:.:.||.:.|::.:|.:.::..||.|:.|:|::||::          
Zfish    12 PTSTL-IPVTTICIFLFIIGVTGNTMTILIIQRFKDMKTTTNLYLSSMAISDLVI---------- 65

  Fly   101 ASMGLPRNLHACLFTVSLLV--VLCTIS-----------IFCLVAVSVDRYWAILYPMAYSRNVR 152
             .:.||.:|:.....|..:.  .:|.:|           |..:..:|::||.||.:|......:.
Zfish    66 -FLSLPFDLYRLWKYVPWIFGEFVCRLSHYINEGCTNATILHITVLSMERYLAICFPFKAKAAIT 129

  Fly   153 TRTAIFIISMCWVAGTIVGFLPLFGWHADVNHNQECL-------------FVEVMDYNYLVFLYF 204
            .|...::|...| ...::...|:| :...|.:..|.:             .:|....:..:::..
Zfish   130 KRRVKYVILALW-GFALLSAAPMF-FLMGVEYENETMPDPGSRQCKHTRYAIESGLLHTTIWVST 192

  Fly   205 ATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLG 269
            |....|...:|..|..|.|.:.|...::...|.|                               
Zfish   193 AYFFCPMFCLLFLYGSIGRKLWKSRHELHGPNAA------------------------------- 226

  Fly   270 AARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDCYVHPKLT----LFCIILSHLNSAVN 330
            |.:|.:.:..:.|:::|..|.|||:| |.|........|.|...:|:    :..::|.:|:::||
Zfish   227 ARQKVNRQTVKILAVVVSVFAICWLP-YHIGRFLFTHVDDYHSARLSQNFNVASMVLFYLSASVN 290

  Fly   331 PVLYAYHLKDFRAALKNLLLKMMG 354
            ||||......:|:|:|.|.|...|
Zfish   291 PVLYNLMSNKYRSAVKRLFLLPRG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 37/193 (19%)
7tm_1 58..334 CDD:278431 61/305 (20%)
mlnrXP_003200046.1 7tm_4 24..>153 CDD:304433 30/141 (21%)
7tm_1 33..294 CDD:278431 61/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.