DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and rxfp1

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001177863.1 Gene:rxfp1 / 100498669 ZFINID:ZDB-GENE-110125-1 Length:748 Species:Danio rerio


Alignment Length:468 Identity:106/468 - (22%)
Similarity:173/468 - (36%) Gaps:148/468 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDAKDSDSPSSEL--NIPYTVFEVLVAIVSIIGNVLVIIV---FRRERKLRRRTNYYIVSLAMAD 87
            |...|..|...:|  ||...||...|:..:..||:.||.:   .|.|.||....   |:||..||
Zfish   385 KPNTDGISSFEDLLANIVLRVFVWAVSATTCFGNIFVICMRSYIRSENKLHAMC---IISLCCAD 446

  Fly    88 LLVGALGIPFAILASMGL----PRNLH--------ACLFTVSLLVVLCTISIFCLVAVSVDRYWA 140
               |.:|:...::.:..|    ..|.|        ||....||.::...:|:..|..:::::|..
Zfish   447 ---GLMGVYLFMIGAYDLKFRGEYNRHAQAGMDSEACQVIGSLAMLSTEVSVLLLTYLTLEKYIC 508

  Fly   141 ILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPL----------------FGWHADVNHNQECL 189
            |:||..|....|.|| :.|:.:.||.|.|:.||||                |..|::   ..|.|
Zfish   509 IVYPFRYLTLGRRRT-VTILVVIWVLGFIIAFLPLLFKGVFRNFYGTNGVCFPLHSE---QPETL 569

  Fly   190 FVEVMDYNYLVFLYFATIITPALLMLAFYTHIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTT 254
            ..::  |:.::||.. .::...:::|::.:..|.:                              
Zfish   570 GAQI--YSIVIFLGL-NLVAFLIIVLSYGSMFYNI------------------------------ 601

  Fly   255 PGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLY---TINCIKAFCPDCYVHPKLT 316
                ..|||.........|:::...:....||:...:||||::   |::.::...|.. :...:.
Zfish   602 ----QRTGTQTTKYSNHIKKELTIAKRFFSIVITDSLCWIPIFILKTLSLMEVEIPGT-ISSWVV 661

  Fly   317 LFCIILSHLNSAVNPVLYAYHLKDFRAALKNLLLKMMGVDIDQQAEAIHRFSVASQHRLQSMDSN 381
            :|.:   .:|||:||:||....:.|    |..||::.                          ||
Zfish   662 IFIL---PINSALNPILYTLTTRPF----KETLLQVW--------------------------SN 693

  Fly   382 MR-------STQPRLYVGEYSPIWLRQQQEALKNSQLLPKCGVVSPCFNNINQTVAAVASVTTDL 439
            .|       |..|.|....:..:|..|:     |||.|  |...|...|            ||.|
Zfish   694 YRQRRPLFSSRPPHLPSFTWQEMWPLQE-----NSQTL--CSHPSDICN------------TTHL 739

  Fly   440 EREMWNIVEASSG 452
            ..     ||||:|
Zfish   740 LP-----VEASNG 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 49/198 (25%)
7tm_1 58..334 CDD:278431 68/309 (22%)
rxfp1NP_001177863.1 LDLa 29..64 CDD:238060
LRR_RI 99..304 CDD:238064
leucine-rich repeat 125..148 CDD:275380
LRR_8 148..207 CDD:290566
leucine-rich repeat 149..172 CDD:275380
leucine-rich repeat 173..196 CDD:275380
LRR_8 196..278 CDD:290566
leucine-rich repeat 197..220 CDD:275380
leucine-rich repeat 221..243 CDD:275380
leucine-rich repeat 244..267 CDD:275380
LRR_8 268..326 CDD:290566
leucine-rich repeat 268..291 CDD:275380
leucine-rich repeat 292..315 CDD:275380
leucine-rich repeat 316..339 CDD:275380
leucine-rich repeat 340..361 CDD:275380
7tm_1 417..676 CDD:278431 68/309 (22%)
7tm_4 <482..>616 CDD:304433 33/174 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.