DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and gpr174

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_002940479.2 Gene:gpr174 / 100494350 XenbaseID:XB-GENE-994529 Length:330 Species:Xenopus tropicalis


Alignment Length:330 Identity:83/330 - (25%)
Similarity:136/330 - (41%) Gaps:69/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAIL--AS 102
            :|..|.:...::.|..:|||||.:.:|....|..:|...::::|::|||: ..|.:|..|.  .:
 Frog    18 VNNIYAITYTIILIPGLIGNVLALWIFYAYIKETKRAVIFMINLSIADLM-QVLSLPLRIFYYLN 81

  Fly   103 MGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMC-WVA 166
            ...|.:...|:|...|..|....|||.||.:||.|:..::||..:  |.|.|.....||:. |:.
 Frog    82 QSWPFSHFVCMFCFYLKYVNMYASIFFLVCISVRRFLYVIYPFKW--NDRKRVCDVYISVAGWIT 144

  Fly   167 GTIVGFL--PLFGWHADVNHNQECLFVEV----MDYNYLVFLYFATIITPALLMLAFYTHIYRVI 225
             ..|..|  ||.....|...|..| ||::    :..|..|.|     :|.|.| ..|.|.:..|:
 Frog   145 -VCVSCLPFPLLRVSNDTTTNDRC-FVDLPLVDIGMNNSVLL-----VTLAEL-FGFVTPLLIVL 201

  Fly   226 IKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFM 290
            ....|.::::.....:|:.                       ||..:    ||.:.:....:.|:
 Frog   202 YCSWRTVMSLREPDSISQD-----------------------LGEKK----KALKMILTCAVVFL 239

  Fly   291 ICWIP---------LYTINCI------KAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKD 340
            ||:.|         |...|.|      ||...   :||    ..:.|:.|||.::||:|.:...:
 Frog   240 ICFAPYHFSFPLDFLVKANKITQCKQRKAILT---LHP----VALCLASLNSCLDPVIYYFTTDE 297

  Fly   341 FRAAL 345
            |:..|
 Frog   298 FKRRL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 53/176 (30%)
7tm_1 58..334 CDD:278431 76/299 (25%)
gpr174XP_002940479.2 7tm_1 36..291 CDD:278431 76/299 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.