DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and LOC100488258

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_012818683.1 Gene:LOC100488258 / 100488258 -ID:- Length:333 Species:Xenopus tropicalis


Alignment Length:333 Identity:86/333 - (25%)
Similarity:148/333 - (44%) Gaps:79/333 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASM-------GLPRNLH 110
            |::.:||:||||.....|:|...||:.|:|||.||.|:|.:.:|::::.|:       .|...:|
 Frog    34 ILTTVGNLLVIISISHFRQLHYPTNFLILSLATADFLIGLVVMPYSMVRSLTSCWYFGDLFCKVH 98

  Fly   111 ACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFLPL 175
            :||.     :.|||.||:.|..:|||||:|:.:|:.|.:|:.|......:...|....:..|..:
 Frog    99 SCLD-----MTLCTGSIYHLFFISVDRYYAVCHPLHYYKNLTTNVIELFLLTTWSVSCVFSFGLV 158

  Fly   176 FGWHADVNHNQECLFVEVMDYNYLVFLY------------FATI------ITPALLMLAFYTHIY 222
            |.     |.:.|.:      .:|:...|            :.||      ..|..||:..|.||:
 Frog   159 FS-----NVHTEGI------QDYITSYYCIGSCSLTLNKLWGTISSLICFFIPGALMIGIYMHIF 212

  Fly   223 RVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVL 287
            .|...|.:.:...:.......:|..:|                       :.:.||.:.|||::.
 Frog   213 SVARNQAKLVHNHHSFQPDKSKSKISV-----------------------RAERKAAKTLSIVMG 254

  Fly   288 FFMICWIPLYTINCIKAFCPDCYVH---PKLTLFCII--LSHLNSAVNPVLYA----YHLKDFRA 343
            .|:.||:|.:.:..|     |.|::   |: .|:.:.  |.:.|||:||::||    :..|.|..
 Frog   255 VFLFCWLPFFILTVI-----DPYINFSVPE-DLYNVFLWLGYFNSALNPIIYALFYPWFQKAFAC 313

  Fly   344 ALKNLLLK 351
            .:...:||
 Frog   314 IISGNILK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 54/191 (28%)
7tm_1 58..334 CDD:278431 79/305 (26%)
LOC100488258XP_012818683.1 7tmA_TAAR2_3_4 23..311 CDD:320437 83/321 (26%)
TM helix 1 24..50 CDD:320437 7/15 (47%)
TM helix 2 57..83 CDD:320437 11/25 (44%)
TM helix 3 95..125 CDD:320437 15/34 (44%)
TM helix 4 137..160 CDD:320437 2/22 (9%)
TM helix 5 185..214 CDD:320437 8/28 (29%)
TM helix 6 240..270 CDD:320437 10/34 (29%)
TM helix 7 279..304 CDD:320437 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.