DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and calhm4

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_002938338.2 Gene:calhm4 / 100486584 XenbaseID:XB-GENE-956190 Length:323 Species:Xenopus tropicalis


Alignment Length:131 Identity:29/131 - (22%)
Similarity:45/131 - (34%) Gaps:42/131 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VFEVLVAIVSIIGNVLV-IIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRNL 109
            :|..:|||:::.|..|. ...|.......:..||   .||.       ||:|..:|..:|...| 
 Frog    17 LFNAVVAILTVGGQQLFSFFAFSCPCSPSKNLNY---GLAF-------LGVPALVLLVVGFVFN- 70

  Fly   110 HACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIIS----MCWVAGTIV 170
                                      |..|.:|...::|..|:.|:....|.    :|:|.|.|.
 Frog    71 --------------------------DNTWRLLMGSSHSHAVQERSRQSTIMKYKLICFVIGNIT 109

  Fly   171 G 171
            |
 Frog   110 G 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 27/125 (22%)
7tm_1 58..334 CDD:278431 25/119 (21%)
calhm4XP_002938338.2 Ca_hom_mod 3..258 CDD:373303 29/131 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.