DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and adora1b

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001122056.1 Gene:adora1b / 100150997 ZFINID:ZDB-GENE-081105-156 Length:341 Species:Danio rerio


Alignment Length:312 Identity:104/312 - (33%)
Similarity:165/312 - (52%) Gaps:40/312 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRN 108
            |...||::|:.|:||||:|:...:..:.||..|..:|||||:||:.||||.||.||..|:||..:
Zfish    12 YMGMEVVIAVSSVIGNVMVVWAVKINKSLRDTTFCFIVSLALADIAVGALVIPLAITISIGLQTH 76

  Fly   109 LHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFL 173
            .::||.....::||...||..|:|:::|||..:..|.:|.|.|..:.|...:.|||:...|||..
Zfish    77 FYSCLLVACTVLVLTQSSILALLAIAIDRYLRVKIPTSYKRVVTPKRAGIAVFMCWMVAFIVGLT 141

  Fly   174 PLFGWH--ADVNHNQE--------CLFVEVMDYNYLV-FLYFATIITPALLMLAFYTHIYRVIIK 227
            |:.||:  ..:..|..        |.|..|:...|:| |.:|..::.|.|.||..|:.|:.:|.|
Zfish   142 PMLGWNNLHSLQQNDSIGPDLIVTCQFENVISMEYMVYFNFFGWVLPPLLFMLVIYSEIFYMIHK 206

  Fly   228 QVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLFFMIC 292
            |:.:.|:.:                :.|.:             ...:::|..::|::::..|.|.
Zfish   207 QLNKKVSSH----------------SEPNK-------------YYDKELKLAKSLALVLFLFAIS 242

  Fly   293 WIPLYTINCIKAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAA 344
            |:||:.:|||..|.|.|.....|....|:|:|.||||||::||:.:|.||.|
Zfish   243 WLPLHIMNCITLFFPTCEKPMFLIYIAILLTHGNSAVNPIVYAFRIKKFRTA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 66/178 (37%)
7tm_1 58..334 CDD:278431 92/286 (32%)
adora1bNP_001122056.1 7tm_4 20..299 CDD:304433 101/304 (33%)
7tm_1 26..284 CDD:278431 92/286 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585509
Domainoid 1 1.000 203 1.000 Domainoid score I2915
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000536
OrthoInspector 1 1.000 - - otm25428
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24246
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X919
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.