DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and cyp4b1

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001120073.1 Gene:cyp4b1 / 100145080 XenbaseID:XB-GENE-5924259 Length:510 Species:Xenopus tropicalis


Alignment Length:88 Identity:24/88 - (27%)
Similarity:31/88 - (35%) Gaps:21/88 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   686 SVLPQHPQPANHPTENFFSPLR--SVGSFMQHSNLFHFLQPHAARPTSSTASSTASTPTPSPPPM 748
            |:...|..||.......|:|||  ...|..:||   |...|.||.|.:....:.|          
 Frog   412 SIYAIHKNPAVWEDPEVFNPLRFSPENSANRHS---HAFLPFAAGPRNCIGQNFA---------- 463

  Fly   749 GQAQEESVPVGLTTS----SPSL 767
              ..|..|.|.||.:    :|.|
 Frog   464 --MNEMKVAVALTLNRFHLAPDL 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433
7tm_1 58..334 CDD:278431
cyp4b1NP_001120073.1 p450 50..503 CDD:278495 24/88 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165169838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24246
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.