DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and ccr3

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001107334.1 Gene:ccr3 / 100135154 XenbaseID:XB-GENE-5897823 Length:345 Species:Xenopus tropicalis


Alignment Length:325 Identity:68/325 - (20%)
Similarity:131/325 - (40%) Gaps:74/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPF-AILASMGLPR 107
            ||||     .:|::||.|::.:..:..|::..||.:|::|.::|||. .:.:|| |...|.....
 Frog    49 YTVF-----TLSLLGNGLILFLLLKYEKIKTVTNLFILNLVISDLLF-TITLPFWAFYHSNEWVF 107

  Fly   108 NLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMC-WVAGTIVG 171
            ....|....|:..:.....|..|..:::|||.|:::.::.:| .|....:::.|:. ||. :.|.
 Frog   108 GNGMCKVVSSVFFIGFFSCILFLTVMTMDRYLAVVHAVSAAR-TRKLIYVYVASIAIWVI-SFVS 170

  Fly   172 FLPLFGWHADVNHNQECLFVEV-------------MDYNYLVFLYFATIITPALLMLAFYTHIYR 223
            .:|.|..:....|:...:..|.             :.|...:.::|   :.|.:::|..||.|  
 Frog   171 TVPKFVLYGTRKHDSAGILCEETGFSADKIDTWRRLGYYQQLTMFF---LFPLIVILYCYTLI-- 230

  Fly   224 VIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSIIVLF 288
                                                    ::::.........||.:.:|:|||.
 Frog   231 ----------------------------------------VVKLFNTKMHNKDKAVKLISVIVLA 255

  Fly   289 FMICWIPLYTINCIKAF----CPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALKNLL 349
            |.|||.|...:..::..    |.| |::....: |..:::.:..:||..|.:....||..|..||
 Frog   256 FFICWTPYNVVIFLRLSPGDPCND-YLNNAFYI-CRNIAYFHCCINPFFYTFVGTKFRRHLSALL 318

  Fly   350  349
             Frog   319  318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 39/182 (21%)
7tm_1 58..334 CDD:278431 57/294 (19%)
ccr3NP_001107334.1 7tm_1 58..303 CDD:278431 57/294 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.