DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and taar13e

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001076512.1 Gene:taar13e / 100034381 ZFINID:ZDB-GENE-041014-70 Length:341 Species:Danio rerio


Alignment Length:350 Identity:87/350 - (24%)
Similarity:162/350 - (46%) Gaps:69/350 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VFEVLVA--IVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASMGLPRN 108
            |:.||.:  .|:|:||.:|||.....::|:..||..::|||:||||:|.:.:||:::      |:
Zfish    35 VYLVLASAMTVTILGNSVVIISIAHFKQLQTPTNILVMSLALADLLLGLVVMPFSMI------RS 93

  Fly   109 LHACLF---TVSLL-----VVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWV 165
            :..|.:   |..||     :.|.::|||.|:.::|||:.|:.:|:.|...:....|..::.:.|.
Zfish    94 VDGCWYYGETFCLLHSSFDMFLTSVSIFHLIFIAVDRHQAVCFPLQYPTMITIPVAWVMVIISWS 158

  Fly   166 AGTIVGFLPLFGWHADVNHNQE------CLFVEVMDYNYL------VFLYFATIITPALLMLAFY 218
            ......:..::. .|:|...:|      |:....:.:|.|      :..:|    .|..:|:..|
Zfish   159 MAAFYSYGLVYS-KANVEGLEEYIESIYCMGGCTLLFNALWGAIDTLVAFF----LPCFVMIGLY 218

  Fly   219 THIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLS 283
            ..|:.:..|..|::...|.                      |....|  ..::|:.:.||.:.|.
Zfish   219 ARIFMIAKKHARKLGEANQ----------------------HDNENL--FKSSRRSERKAAKTLG 259

  Fly   284 IIVLFFMICWIPLYTINCIKAFCPDCYVH---PKLTLFCII-LSHLNSAVNPVLYAYHLKDFRAA 344
            |:|..|:|||:|.: ||.:.    |.|::   |.:.....: |.::|||:||::|......||..
Zfish   260 IVVGAFVICWLPFF-INSMM----DPYINFSTPGVLFEAFVWLGYMNSAINPIIYGLFYPWFRKT 319

  Fly   345 LKNLLLKMMGVDIDQQAEAIHRFSV 369
            |..::...|   .:..:..|:.|:|
Zfish   320 LYLIITLRM---FEPNSSDINVFTV 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 48/189 (25%)
7tm_1 58..334 CDD:278431 74/299 (25%)
taar13eNP_001076512.1 7tm_4 43..>269 CDD:304433 62/260 (24%)
7tm_1 49..309 CDD:278431 74/299 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.