DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and taar15

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001076508.1 Gene:taar15 / 100034377 ZFINID:ZDB-GENE-041014-50 Length:328 Species:Danio rerio


Alignment Length:333 Identity:81/333 - (24%)
Similarity:152/333 - (45%) Gaps:73/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILAS 102
            |.:|:...::...::::::.||:|||:.....::|...||..|:|||::|||||...:|...:  
Zfish    23 SYVNVFLFLYISAISVLTVCGNLLVIVSITVFKQLHTPTNLLILSLAISDLLVGICLMPVESI-- 85

  Fly   103 MGLPRNLHACLFT--------VSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFI 159
                |::::|.:.        .|::.::.:.|:..::.|::|||:|:..|:.|...:..|.|:..
Zfish    86 ----RSINSCFYMGKSHCHIFHSIMSIVGSASLMNIMLVAIDRYFAVCNPLLYMSKMTIRKALIC 146

  Fly   160 ISMCWVAGTIVGFLPLFGWHAD-----VNHNQECLFVEVMDYNYLVFLYFATIITPALLMLAFYT 219
            :.:.|........:|:...::|     |...:||.......:.....:  .:.|.|.::||..||
Zfish   147 VCLGWTVSICYNLVPVNLGNSDPTGAVVVCLRECAVAVSNSWGPADLI--VSFIAPCIMMLILYT 209

  Fly   220 HIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSI 284
            .|..|.:||.:.|      |::::::.:.                     .:||.:||||:.||.
Zfish   210 RILTVALKQAKAI------SNMTKKNGSQ---------------------PSRKSEVKATKTLST 247

  Fly   285 IVLFFMICWIPLYTIN-----------CIKAFCPDCYVHPKLTLFCIILSHLNSAVNPVLYAYHL 338
            |:..:.|||||.|.|.           .|.||         |.||     :.||.:||.:||...
Zfish   248 IIFVYFICWIPWYVIMLNMEQFNKLPVSISAF---------LCLF-----YTNSCINPFIYAISY 298

  Fly   339 KDFRAALK 346
            ..|:.::|
Zfish   299 PWFKRSVK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 42/180 (23%)
7tm_1 58..334 CDD:278431 75/299 (25%)
taar15NP_001076508.1 7tm_4 37..>135 CDD:304433 28/103 (27%)
7tm_1 43..294 CDD:278431 75/299 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.