DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and hrh2b

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001103208.1 Gene:hrh2b / 100005590 ZFINID:ZDB-GENE-070928-20 Length:335 Species:Danio rerio


Alignment Length:329 Identity:98/329 - (29%)
Similarity:153/329 - (46%) Gaps:59/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLVAIV--SIIGNVLVIIVFRRERKLRRRTNYYIVSLAMADLLVGALGIPFAILASM---GLPRN 108
            ||||.:  :|.||:||.:.....|:|.:.::.:|:|||:.|||:|.|.:|.:.:..:   ..|..
Zfish    10 VLVAFIALTICGNILVCMAVATSRRLHQLSSCFILSLAVTDLLLGLLVLPLSAMLELRNGKWPLG 74

  Fly   109 LHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRNVRTRTAIFIISMCWVAGTIVGFL 173
            ...|...:|:.|:|.:.||..|:|:|||||.||..|:.|.|.|..|.....::..|.....|.|:
Zfish    75 GVFCNIYISMDVMLSSASILTLLAISVDRYLAISNPLFYPRRVTPRRVAIALTAIWTCSLAVSFV 139

  Fly   174 PL-FGWHADVNHNQECLFVEVMDY------------------NYLVFLYFATIITPALLMLAFYT 219
            .: .||      |.....|:.:|:                  ||::...|.....|.|:|...|.
Zfish   140 SINLGW------NSPDFRVQNLDWSMWGEGEEGRTCRYEWNNNYVLLKAFGIFYLPLLVMCGMYH 198

  Fly   220 HIYRVIIKQVRQIVTMNPASDLSRRSSAAVVQVTTPGRGGHTGTMLRVLGAARKRDVKATQNLSI 284
            .|:.|..:|||:|....|:|  ::.::|                      ||..|:.|||..|:.
Zfish   199 RIFCVAREQVRRIRAATPSS--AQAANA----------------------AATAREHKATVTLAA 239

  Fly   285 IVLFFMICWIPLYTINCIKAFCPDCYVHP-KLTLFCII-LSHLNSAVNPVLYAYHLKDFRAALKN 347
            ::..|:|||.|.:|.........   :|| |||...:: |.:||||:||:||....:||..|...
Zfish   240 VLGAFIICWFPYFTYFTYMGMWA---IHPNKLTHSIVLWLGYLNSALNPILYPALNRDFHQACGQ 301

  Fly   348 LLLK 351
            ||.:
Zfish   302 LLCR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 54/191 (28%)
7tm_1 58..334 CDD:278431 86/299 (29%)
hrh2bNP_001103208.1 7tm_1 21..288 CDD:278431 86/299 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.