DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdoR and htr1fb

DIOPT Version :9

Sequence 1:NP_651772.1 Gene:AdoR / 43583 FlyBaseID:FBgn0039747 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_005159986.1 Gene:htr1fb / 100004819 ZFINID:ZDB-GENE-090312-140 Length:372 Species:Danio rerio


Alignment Length:365 Identity:104/365 - (28%)
Similarity:160/365 - (43%) Gaps:48/365 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TSKDAKD---SDSPSSELNIPYTVFEVLVAIVSIIGNVLVIIVFRRERKLRRRTNYYIVSLAMAD 87
            ||.|..|   |....|::.:..|:..:.||..:|  |.|||......|||.:..||.|.|||:.|
Zfish     7 TSVDLSDVLASKMSPSKILLSLTLSFLAVATTAI--NSLVITAILITRKLHQPANYLICSLAVTD 69

  Fly    88 LLVGALGIPFAI--LASMGLPRNLHACLFTVSLLVVLCTISIFCLVAVSVDRYWAILYPMAYSRN 150
            |||..|.:|.:|  :|..........|...:.:.|..||.||..|.|:::|||.||...:|||:.
Zfish    70 LLVAVLVMPVSIVYIAEETWVLGPIVCHLWLGVDVTCCTCSILHLAAIALDRYRAITDAVAYSQK 134

  Fly   151 VRTRTAIFIISMCWVAGTIVGFLPLFGWHA--------DVNHNQECLFVEVMDYNYLVFLYFAT- 206
            ...:..|..|...|....:|...||. |..        ......:||    ::::::.|..::| 
Zfish   135 RTYKRVIVTILSLWTLSILVSLPPLV-WRKFPKVEFKDGKREPMDCL----IEHDHVAFTVYSTF 194

  Fly   207 --IITPALLMLAFYTHIYRV------------IIKQ-VRQIVTMNPASD----LSRRSSAAVVQ- 251
              ...|..|:|..|..||:.            ::|| |..::....:||    ||..|...:.: 
Zfish   195 GAFYIPLALILVLYYKIYKAAEMLRNRRGSSRLVKQTVSSVMLPGMSSDKDIALSPDSFCPIEKS 259

  Fly   252 VTTPGRGGH-------TGTMLRVLGAARKRDVKATQNLSIIVLFFMICWIPLYTINCIKAFCPDC 309
            .:.|...|.       :|.::||......|:.:|...|.:|:..|::||:|.:....|...||.|
Zfish   260 FSDPSTDGERVRITSSSGNLIRVRRNPGARERRAALTLGLILGAFVVCWLPFFLKEVIVNICPTC 324

  Fly   310 YVHPKLTLFCIILSHLNSAVNPVLYAYHLKDFRAALKNLL 349
            .....|..|...|.:|||.:||::|....:||:.|.|.||
Zfish   325 TTSAVLADFLTWLGYLNSLINPLIYTIFNEDFKKAFKKLL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdoRNP_651772.1 7tm_4 52..>220 CDD:304433 54/180 (30%)
7tm_1 58..334 CDD:278431 87/313 (28%)
htr1fbXP_005159986.1 7tm_1 41..349 CDD:278431 87/312 (28%)
7tm_4 41..>165 CDD:304433 44/124 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.