DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and KRT36

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_003762.1 Gene:KRT36 / 8689 HGNCID:6454 Length:467 Species:Homo sapiens


Alignment Length:306 Identity:65/306 - (21%)
Similarity:112/306 - (36%) Gaps:67/306 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 PVYSCPNVDDDCVTFEPPAGPATQFS------SCQKNVLGEGNANRLCQKHSSPRLRQMHISNTR 376
            |.:|..::...|.|    ||..::.|      ||:...|. |.|..:....|.       :|...
Human     8 PTFSTGSIKGLCGT----AGGISRVSSIRSVGSCRVPSLA-GAAGYISSARSG-------LSGLG 60

  Fly   377 SCVLCGEDVSWLPKVAACPCCGYKPVPE---FKERPYD-EQATAQQILLDHLENPVENLSFDMGS 437
            || |.|..:|     :.|...|:  |..   |.|..:: .:....|.|.|.|.|.:|.:.    .
Human    61 SC-LPGSYLS-----SECHTSGF--VGSGGWFCEGSFNGSEKETMQFLNDRLANYLEKVR----Q 113

  Fly   438 VEGCSANEEHGVPE----------PTSEAFEAIVKDYQ---LLRRS------IRESNTK------ 477
            :|..:|..|..:.|          |..:::...::|:|   ||.:|      ::..|.|      
Human   114 LERENAELESRIQEWYEFQIPYICPDYQSYFKTIEDFQQKILLTKSENARLVLQIDNAKLAADDF 178

  Fly   478 ATQSATKNPTAQEGSAQPQDLAKVFTELRDLFNVKAADENQKIQDICAEACALAKSHKKSKNRPA 542
            .|:..|:....|...|....|.::..||    .:..||...:::.:..|...|.|:|::.    .
Human   179 RTKYETELSLRQLVEADINGLRRILDEL----TLCKADLEAQVESLKEELMCLKKNHEEE----V 235

  Fly   543 SPERTKAGKTDPVEDACETPRKMKKRRPKVKRPYKSRYYSMYRPTE 588
            |..|.:.|....||.....|..:.|....::..|::...:..|..|
Human   236 SVLRCQLGDRLNVEVDAAPPVDLNKILEDMRCQYEALVENNRRDVE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651
DUF4776 371..848 CDD:292622 52/247 (21%)
KRT36NP_003762.1 Head 1..93 24/104 (23%)
Filament 92..403 CDD:278467 41/202 (20%)
Coil 1A 94..128 9/37 (24%)
Linker 1 129..139 0/9 (0%)
Coil 1B 140..240 21/107 (20%)
Linker 12 241..256 3/14 (21%)
Coil 2 257..400 4/25 (16%)
Tail 401..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.