DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and KRT38

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_006762.3 Gene:KRT38 / 8687 HGNCID:6456 Length:456 Species:Homo sapiens


Alignment Length:244 Identity:53/244 - (21%)
Similarity:79/244 - (32%) Gaps:56/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 MAGPYPVYSCPNVDDDCVTFEPPAGPATQFS---SCQKNVLGEGNANRLCQKHSSPRLRQMHISN 374
            |...|...|||.   .| |..|.|...:...   .||..  .|.|...:|...:.....::.:.:
Human     1 MTSSYSSSSCPL---GC-TMAPGARNVSVSPIDIGCQPG--AEANIAPMCLLANVAHANRVRVGS 59

  Fly   375 TRSCVLCGEDVSWLPKV--AACPCCGYKPVP-------EFKERPYD-EQATAQQILLDHLENPVE 429
            |.    .|.....||..  .|||..|...:|       .:.|...: .:....|.|.|.|.|.:|
Human    60 TP----LGRPSLCLPPTCHTACPLPGTCHIPGNIGICGAYGENTLNGHEKETMQFLNDRLANYLE 120

  Fly   430 NLSFDMGSVEGCSANEEHGVPEPT----SEAFEAIV-KDYQLLRRSIRESNTKATQSATKNPTAQ 489
            .:.         ...:|:...|.|    |:..|:.| .|||....:|.|...|...|..:|    
Human   121 KVR---------QLEQENAELEATLLERSKCHESTVCPDYQSYFHTIEELQQKILCSKAEN---- 172

  Fly   490 EGSAQPQDLAKVFTEL------RDLFNVKAADENQKIQDICAEACALAK 532
                     |::..::      .|.|.:|...|....|.:.|:.|...|
Human   173 ---------ARLIVQIDNAKLAADDFRIKLESERSLRQLVEADKCGTQK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651
DUF4776 371..848 CDD:292622 39/183 (21%)
KRT38NP_006762.3 Head 1..104 24/112 (21%)
Filament 104..414 CDD:278467 29/131 (22%)
Coil 1A 105..139 9/42 (21%)
Linker 1 140..150 3/9 (33%)
Coil 1B 151..251 16/75 (21%)
Spc24 204..>273 CDD:285486 3/9 (33%)
Linker 12 252..267
Coil 2 268..411
Tail 412..456
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.