DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and Krt24

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_083669.1 Gene:Krt24 / 75706 MGIID:1922956 Length:512 Species:Mus musculus


Alignment Length:151 Identity:31/151 - (20%)
Similarity:56/151 - (37%) Gaps:38/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 EAECLQRQLAE---GINISVVYLRKEIARGC------------YFPPAAVVSRMINDFDEIVHDA 209
            ||.|.:.::.|   .:....:.|:.::|..|            |....:.:...|:..:|.:...
Mouse   352 EANCARSEVMELKRTVQTLEIELQSQLALKCSLEGTLADTEAGYVAQLSGIQAQISSLEEQLSQI 416

  Fly   210 NVELTCKG----CTVGIMNIRFAMQMRCQTLKEDAVDGRLAGGQERGC-FPNM---NVDLQDLSF 266
            ..|..|:.    |   ::||:..::...:|.:      ||..|...|| :.|:   ||.|.|...
Mouse   417 RAETQCQSAEYEC---LLNIKTRLEQEIETYR------RLLNGDGGGCDYRNLVSKNVVLSDSGS 472

  Fly   267 MSTSSIDPCVGFMPSDTEVAQ 287
            .:....|      ||.|.|.:
Mouse   473 CAGQGKD------PSKTRVTK 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 31/151 (21%)
DUF4776 371..848 CDD:292622
Krt24NP_083669.1 Head 1..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Filament 140..450 CDD:278467 18/106 (17%)
Coil 1A 141..176
Linker 1 177..197
Coil 1B 198..289
Linker 12 290..312
Coil 2 313..451 18/107 (17%)
Tail 452..512 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.