DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and Krt25

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_598491.1 Gene:Krt25 / 70810 MGIID:1918060 Length:446 Species:Mus musculus


Alignment Length:178 Identity:31/178 - (17%)
Similarity:52/178 - (29%) Gaps:75/178 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 CLGSSSINV--NCLP-------LN----------------PDKTFQMEAECLQRQLAEGINISVV 177
            |....::||  |..|       ||                .:..||.::..||:|:.|.:. :..
Mouse   226 CAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFQEKSASLQQQITEDVG-ATT 289

  Fly   178 YLRKEI------------------------------ARGCYFPPAAVVSRMINDFDEIVHDANVE 212
            ..|.|:                              ..|.|....|.:...|:..:|.:|....|
Mouse   290 SARNELTEMKRTLQTLEIELQSLLATKHSLECSLTETEGNYCTQLAQIQAQISALEEQLHQVRTE 354

  Fly   213 LTCKGCTVG-------IMNIRFAMQMRCQTLKEDAVDGRLAGGQERGC 253
                  |.|       ::|::..::...:|.      ..|.||.|..|
Mouse   355 ------TEGQKLEYEQLLNVKAHLEKEIETY------CLLIGGDEGAC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 31/178 (17%)
DUF4776 371..848 CDD:292622
Krt25NP_598491.1 Head. /evidence=ECO:0000255 1..74
Filament 74..387 CDD:278467 29/173 (17%)
Coil 1A. /evidence=ECO:0000255 75..110
Linker 1. /evidence=ECO:0000255 111..132
Coil 1B. /evidence=ECO:0000255 133..224
Linker 12. /evidence=ECO:0000255 225..247 5/20 (25%)
Coil 2. /evidence=ECO:0000255 248..386 23/150 (15%)
YlqD 334..>377 CDD:287979 8/48 (17%)
Tail. /evidence=ECO:0000255 387..446 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.