DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ppi1 and Krt42

DIOPT Version :9

Sequence 1:	NP_733345.2	Gene:	Ppi1 / 43581	FlyBaseID:	FBgn0051025	Length:	998	Species:	Drosophila melanogaster
Sequence 2:	NP_997648.2	Gene:	Krt42 / 68239	MGIID:	1915489	Length:	452	Species:	Mus musculus

Alignment Length:	100	Identity:	23/100 - (23%)
Similarity:	47/100 - (47%)	Gaps:	7/100 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   458 EAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQP-QDLAKVFTELRDLFNVKAADENQKIQ 521
            |::.::...||:: .|....|.:.........|..|.| .||:::..|:||.:. |.|::|:|
Mouse   219 ESLKEELAYLRKN-HEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYE-KMAEKNRK-- 279

  Fly   522 DICAEACALAKSHKKSKNRPASPERTKAGKTDPVE 556
              .||.....|:.:.::....:.|..::.:|:..|
Mouse   280 --DAEEWFFTKTEELNREVATNTEALQSSRTEITE 312

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ppi1	NP_733345.2	DUF4788	108..>294	CDD:292651
Ppi1	NP_733345.2	DUF4776	371..848	CDD:292622	22/99 (22%)
Krt42	NP_997648.2	Head. /evidence=ECO:0000255	4..93
		Filament	93..404	CDD:278467	22/99 (22%)
		Coil 1A. /evidence=ECO:0000255	94..129
		Linker 1. /evidence=ECO:0000255	130..147
		Coil 1B. /evidence=ECO:0000255	148..239		4/20 (20%)
		FliD_C	<236..358	CDD:284583	18/81 (22%)
		Linker 12. /evidence=ECO:0000255	240..262		5/21 (24%)
		Coil 2. /evidence=ECO:0000255	263..401		12/54 (22%)
		Tail. /evidence=ECO:0000255	402..452
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_28M49
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900