powered by:
Protein Alignment Ppi1 and krt1-19d
DIOPT Version :9
Sequence 1: | NP_733345.2 |
Gene: | Ppi1 / 43581 |
FlyBaseID: | FBgn0051025 |
Length: | 998 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001342789.4 |
Gene: | krt1-19d / 664718 |
ZFINID: | ZDB-GENE-060316-1 |
Length: | 423 |
Species: | Danio rerio |
Alignment Length: | 64 |
Identity: | 12/64 - (18%) |
Similarity: | 29/64 - (45%) |
Gaps: | 0/64 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 458 EAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQPQDLAKVFTELRDLFNVKAADENQKIQ 521
|.:.::...|:::..|....|....:.....:..:|..|||.|:..|:|:.:....|...::::
Zfish 198 EGLKEELVFLKKNHEEDLLAARAQMSGQVHVEVDAAPHQDLTKILAEIREHYEAVTAKNQRELE 261
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ppi1 | NP_733345.2 |
DUF4788 |
108..>294 |
CDD:292651 |
|
DUF4776 |
371..848 |
CDD:292622 |
12/64 (19%) |
krt1-19d | XP_001342789.4 |
Filament |
72..380 |
CDD:278467 |
12/64 (19%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_28M49 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.