Sequence 1: | NP_733345.2 | Gene: | Ppi1 / 43581 | FlyBaseID: | FBgn0051025 | Length: | 998 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107814.1 | Gene: | krtt1c19e / 553371 | ZFINID: | ZDB-GENE-050506-95 | Length: | 473 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 46/205 - (22%) |
---|---|---|---|
Similarity: | 81/205 - (39%) | Gaps: | 42/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 411 DEQATAQQILLDHLENPVENLSFDMGSVEGCSANEEHGVPE-------PTS-----EAFEAIVKD 463
Fly 464 YQ-----------LLRRSIRESNTKATQSATK--NPTAQEGSAQPQDLAKVFTELRDLFNVKAAD 515
Fly 516 ENQKIQDICAEACALAKSHKKSKNRPASPERTK-AGKTDPVEDACETPRKMKKRRPKVKRPYKSR 579
Fly 580 YYSMYRPTER 589 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppi1 | NP_733345.2 | DUF4788 | 108..>294 | CDD:292651 | |
DUF4776 | 371..848 | CDD:292622 | 46/205 (22%) | ||
krtt1c19e | NP_001107814.1 | Filament | 113..423 | CDD:278467 | 46/205 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_28M49 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |