DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and Krt42

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_001008816.1 Gene:Krt42 / 450231 RGDID:1359182 Length:452 Species:Rattus norvegicus


Alignment Length:216 Identity:45/216 - (20%)
Similarity:81/216 - (37%) Gaps:39/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 RLRQMHISNTRSCVLCGEDVSWLPKVAACPCCGYKP----VPEFKER----PYDEQATAQQI--- 419
            |:|.:..:||...|...|   |..|....|...|.|    :.:.:.:    ..|..:...||   
  Rat   111 RVRALEEANTDLEVKIRE---WYKKQGPGPARDYSPYFKTIEDLRNKILAATIDNASIVLQIDNA 172

  Fly   420 --LLDHLENPVE-NLSFDMGSVEGCSANEEHGVPEPTSE----------AFEAIVKDYQLLRRSI 471
              ..|......| .|:..| |||.    :.:|:.....|          ..|.:.::...|::: 
  Rat   173 RLAADDFRTKYETELNLRM-SVEA----DINGLRRVLDELTLARADLEMQIETLKEELAYLKKN- 231

  Fly   472 RESNTKATQSATKNPTAQEGSAQP-QDLAKVFTELRDLFNVKAADENQKIQDICAEACALAKSHK 535
            .|....|.:.........|..|.| .||:::..|:||.:. |.|::|:|    .||.....|:.:
  Rat   232 HEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYE-KMAEKNRK----DAEEWFFTKTEE 291

  Fly   536 KSKNRPASPERTKAGKTDPVE 556
            .::....:.|..::.:|:..|
  Rat   292 LNREVATNTEALQSSRTEITE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651
DUF4776 371..848 CDD:292622 43/211 (20%)
Krt42NP_001008816.1 Head. /evidence=ECO:0000255 4..93
Filament 93..404 CDD:278467 45/216 (21%)
Coil 1A. /evidence=ECO:0000255 94..129 6/20 (30%)
Linker 1. /evidence=ECO:0000255 130..147 4/16 (25%)
Coil 1B. /evidence=ECO:0000255 148..239 15/96 (16%)
FliD_C 192..361 CDD:284583 27/131 (21%)
Linker 12. /evidence=ECO:0000255 240..262 5/21 (24%)
Coil 2. /evidence=ECO:0000255 263..401 13/55 (24%)
Tail. /evidence=ECO:0000255 402..452
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.