DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and KRT32

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_002269.3 Gene:KRT32 / 3882 HGNCID:6449 Length:448 Species:Homo sapiens


Alignment Length:472 Identity:76/472 - (16%)
Similarity:141/472 - (29%) Gaps:198/472 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SSCPVRNREEVYQPRCPAPGQKGKPNRDYMRCFAAKLIVQKLNMPGRDFECQDKLQIKANVCR-- 133
            |||.|.|..:.....||.|                                       |:||.  
Human     3 SSCCVTNNLQASLKSCPRP---------------------------------------ASVCSSG 28

  Fly   134 -GCK--ICLGSSSINVNCLPLNPDKTFQMEAECLQRQLAEGINISVVYLRKEIARGCYFPPAAVV 195
             .|:  :|||.....:.|||          :.||...                     |.||:.:
Human    29 VNCRPELCLGYVCQPMACLP----------SVCLPTT---------------------FRPASCL 62

  Fly   196 SRMINDFDEIVHDANVELTCKGCTVGIMNIRFAMQMRCQTLKEDAVDGRLAGGQ--ERGCFPNMN 258
            |:..                             :...||.  ...:.|.:..|.  ..|.| |.|
Human    63 SKTY-----------------------------LSSSCQA--ASGISGSMGPGSWYSEGAF-NGN 95

  Fly   259 VDLQDLSFMSTSSIDPCVGFMPSDTEVAQDSPPCSEDRAQDSFQCQDSPPRLIDMAGPYPVYSCP 323
             :.:.:.|::    |....::....::.|::... |.|.|::     |..:::.|.        |
Human    96 -EKETMQFLN----DRLASYLTRVRQLEQENAEL-ESRIQEA-----SHSQVLTMT--------P 141

  Fly   324 NVDDDCVTFEPPAGPATQFSSCQKNVLGEGNANRLCQKHSSPRLRQMHISNTRSCVLCGEDVSWL 388
            :......|.|          ..|:.:        ||.|..:.|: .::|.|.             
Human   142 DYQSHFRTIE----------ELQQKI--------LCTKAENARM-VVNIDNA------------- 174

  Fly   389 PKVAACPCCGYKPVPEFKERPYDEQATAQQILLDHLENPVENLSFDMGSVEGCSANEEHGVPEPT 453
             |:||         .:|:.: |:.:...:|:    :|..:..|...:..:..|.|:.|..|    
Human   175 -KLAA---------DDFRAK-YEAELAMRQL----VEADINGLRRILDDLTLCKADLEAQV---- 220

  Fly   454 SEAFEAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQPQDLAKVFTELR------------ 506
                |::.::...|:::..|...............:..:|.|.||.:|..|:|            
Human   221 ----ESLKEELMCLKKNHEEEVGSLRCQLGDRLNIEVDAAPPVDLTRVLEEMRCQYEAMVEANRR 281

  Fly   507 ---DLFNVKAADENQKI 520
               :.||::..:.||::
Human   282 DVEEWFNMQMEELNQQV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 27/192 (14%)
DUF4776 371..848 CDD:292622 28/165 (17%)
KRT32NP_002269.3 Head 1..96 32/195 (16%)
Filament 95..406 CDD:278467 45/278 (16%)
Coil 1A 97..131 6/38 (16%)
Uso1_p115_C 112..230 CDD:282695 29/186 (16%)
Linker 1 132..142 2/17 (12%)
Coil 1B 143..243 24/154 (16%)
Linker 12 244..259 1/14 (7%)
Coil 2 260..403 9/39 (23%)
Prefoldin 275..>355 CDD:298833 4/24 (17%)
Tail 404..448
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.