DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and KRT19

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_002267.2 Gene:KRT19 / 3880 HGNCID:6436 Length:400 Species:Homo sapiens


Alignment Length:327 Identity:60/327 - (18%)
Similarity:107/327 - (32%) Gaps:117/327 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 AVDGRLAGGQERGCFPNMNVDLQDLSFMSTSSIDPCVGFMPSDTEVAQDSPPCSEDRAQDSFQCQ 304
            |.||.|||        |..:.:|:|:....|.:|.......::.|:        |.:.:|.:|.|
Human    71 ASDGLLAG--------NEKLTMQNLNDRLASYLDKVRALEAANGEL--------EVKIRDWYQKQ 119

  Fly   305 DSPPRLIDMAGPYPVYSCPNVDDDCVTFEPPAGPATQFS-------SCQKNVLGEGNAN-RLCQK 361
                      ||                    ||:..:|       ..:..:||....| |:.  
Human   120 ----------GP--------------------GPSRDYSHYYTTIQDLRDKILGATIENSRIV-- 152

  Fly   362 HSSPRLRQMHISNTRSCVLCGEDVSWLPKVAACPCCGYKPVPEFKERPYDEQATAQQILLD--HL 424
                    :.|.|.|   |..:|                    |:.:...|||....:..|  .|
Human   153 --------LQIDNAR---LAADD--------------------FRTKFETEQALRMSVEADINGL 186

  Fly   425 ENPVENLSFDMGSVEGCSANEEHGVPEPTSEAFEAIVKDYQLLRRSIRESNTKATQSATKNPTAQ 489
            ...::.|:.....:|               ...|.:.::...|:::..|..:..........:.:
Human   187 RRVLDELTLARTDLE---------------MQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVE 236

  Fly   490 EGSAQPQDLAKVFTELRDLFNVKAADENQKIQDICAEACALAKSHKKSKNRPASPERTKAGKTDP 554
            ..||...||||:.:::|..:.| .|::|:|      :|.|...|..:..||..      ||.|:.
Human   237 VDSAPGTDLAKILSDMRSQYEV-MAEQNRK------DAEAWFTSRTEELNREV------AGHTEQ 288

  Fly   555 VE 556
            ::
Human   289 LQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 12/53 (23%)
DUF4776 371..848 CDD:292622 35/188 (19%)
KRT19NP_002267.2 Head 1..79 6/15 (40%)
Filament 79..390 CDD:278467 54/311 (17%)
Coil 1A 80..115 6/42 (14%)
Linker 1 116..133 7/46 (15%)
Coil 1B 134..225 20/138 (14%)
Linker 12 226..248 5/21 (24%)
Necessary for interaction with PNN. /evidence=ECO:0000269|PubMed:10809736 244..390 17/60 (28%)
Coil 2 249..387 13/55 (24%)
Rod-like helical tail 388..400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.