DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and KRT13

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_705694.3 Gene:KRT13 / 3860 HGNCID:6415 Length:458 Species:Homo sapiens


Alignment Length:250 Identity:47/250 - (18%)
Similarity:91/250 - (36%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 AGPATQFSSCQKNVLGEGNANRLCQKHSSPRLRQMHISNTRSCVLCGEDV-----SW-LPKVAAC 394
            ||....|.:|...:| .|| .::..::.:.||.. ::...|:......|:     .| |.:..|.
Human    86 AGGFVDFGACDGGLL-TGN-EKITMQNLNDRLAS-YLEKVRALEEANADLEVKIRDWHLKQSPAS 147

  Fly   395 PCCGYKPVPEFKERPYDEQATA----QQILL---------DHLENPVENLSFDMGSVEGCSANEE 446
            |...|.|..:..|...|:..||    .:::|         |......||......|||.    :.
Human   148 PERDYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELALRQSVEA----DI 208

  Fly   447 HGVPEPTSE----------AFEAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQPQDLAKV 501
            :|:.....|          ..|::.::...::::..|...:.:.........:..:....||.:|
Human   209 NGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRV 273

  Fly   502 FTELRDLFNVKAADENQKIQDICAEACALAKSHKKSKNRPASPERTKAGKTDPVE 556
            ..|:|:.:.. .|:.|::    .||.....||.:.:|....:....:..||:..|
Human   274 LAEMREQYEA-MAERNRR----DAEEWFHTKSAELNKEVSTNTAMIQTSKTEITE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651
DUF4776 371..848 CDD:292622 37/214 (17%)
KRT13NP_705694.3 Head 1..103 5/17 (29%)
Filament 103..415 CDD:306535 40/231 (17%)
Coil 1A 104..139 4/35 (11%)
Linker 1 140..158 5/17 (29%)
Coil 1B 159..250 15/94 (16%)
Linker 12 251..273 2/21 (10%)
Coil 2 274..412 11/54 (20%)
Tail 413..458
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.