DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and KRT12

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_000214.1 Gene:KRT12 / 3859 HGNCID:6414 Length:494 Species:Homo sapiens


Alignment Length:342 Identity:65/342 - (19%)
Similarity:107/342 - (31%) Gaps:130/342 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DGRLAGGQERGCFPNMNVDLQDLSFMSTSSIDPCVGFMPSDTEVAQDSPPCSEDRAQDSFQCQDS 306
            ||.|..|.|:....|:|..|       .|.:|.......::||:........|.|...:.....|
Human   117 DGGLLSGSEKETMQNLNDRL-------ASYLDKVRALEEANTELENKIREWYETRGTGTADASQS 174

  Fly   307 PPRLIDMAGPYPVYSCPNVDDDCVTFEPPAGPATQFSSCQKNVLGE--GNANRLCQKHSSPRLRQ 369
                 |.:..||:     ::|                 .:..::..  |||..|.|         
Human   175 -----DYSKYYPL-----IED-----------------LRNKIISASIGNAQLLLQ--------- 203

  Fly   370 MHISNTRSCVLCGEDVSWLPKVAACPCCGYKPVPEFKERPYDEQATAQQI---------LLDH-- 423
              |.|.|   |..||                    |:.:..:|.|..|.:         :||.  
Human   204 --IDNAR---LAAED--------------------FRMKYENELALRQGVEADINGLRRVLDELT 243

  Fly   424 -----LENPVENLSFDMGSVEGCSANEEH-------GVPEPTSEAFEA--------IVKDYQLLR 468
                 ||..:|:|:.::..::   .|.|.       |.|...|...:|        ::.|.:...
Human   244 LTRTDLEMQIESLNEELAYMK---KNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLNDMRAQY 305

  Fly   469 RSIRESNTKATQS-------------ATKNPTAQEGSAQPQDLAKVF----TELRDLFNVKAADE 516
            .:|.|.|.|..::             :|.....|...::..||.:.|    .||:....:|    
Human   306 ETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMK---- 366

  Fly   517 NQKIQDICAEA----CA 529
             :.::|..|||    ||
Human   367 -KSLEDSLAEAEGDYCA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 12/51 (24%)
DUF4776 371..848 CDD:292622 41/211 (19%)
KRT12NP_000214.1 Head 1..124 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Filament 124..436 CDD:278467 61/335 (18%)
Coil 1A 125..160 8/41 (20%)
Linker 1 164..182 4/22 (18%)
Coil 1B 183..274 24/144 (17%)
Linker 12 275..297 4/21 (19%)
Coil 2 298..435 19/90 (21%)
Tail 436..494
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..468
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.