DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and KRT10

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_001366295.1 Gene:KRT10 / 3858 HGNCID:6413 Length:624 Species:Homo sapiens


Alignment Length:183 Identity:38/183 - (20%)
Similarity:73/183 - (39%) Gaps:39/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 SWLPKVAACPCCGYKPVPEFKERPYDEQATAQQ----------ILLDHLENPVENLSFDMGSV-- 438
            |:|.||.|.....|:...:.||. |::...:.|          ..:|.|:|.:.||:.|..::  
Human   159 SYLDKVRALEESNYELEGKIKEW-YEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILL 222

  Fly   439 ---EGCSANEEHGVPEPTSEAF-EAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQPQDLA 499
               ....|.::..:......|. :::..|...|||.:.|      .:.||.....:..:..::||
Human   223 QIDNARLAADDFRLKYENEVALRQSVEADINGLRRVLDE------LTLTKADLEMQIESLTEELA 281

  Fly   500 KV----FTELRDLFNVKAADEN------------QKIQDICAEACALAKSHKK 536
            .:    ..|::||.||...|.|            |.:.::.::...||:.::|
Human   282 YLKKNHEEEMKDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651
DUF4776 371..848 CDD:292622 38/183 (21%)
KRT10NP_001366295.1 Head 1..145
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Filament 145..454 CDD:365827 38/183 (21%)
Coil 1A 146..181 7/21 (33%)
Linker 1 182..202 2/19 (11%)
Coil 1B 203..294 18/96 (19%)
Linker 12 295..317 4/21 (19%)
Coil 2 318..456 3/17 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.