DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and KRT9

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_000217.2 Gene:KRT9 / 3857 HGNCID:6447 Length:623 Species:Homo sapiens


Alignment Length:350 Identity:58/350 - (16%)
Similarity:107/350 - (30%) Gaps:141/350 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 AGGQERGCF-PNMNVDLQDLSFMSTSSIDPCVGFMPSDTEVAQDSPPCSEDRAQDSFQCQDSPPR 309
            |||.:.|.. .|....:|:|:....|.:|.......::.::        |::.||.:        
Human   141 AGGGDGGILTANEKSTMQELNSRLASYLDKVQALEEANNDL--------ENKIQDWY-------- 189

  Fly   310 LIDMAGP-------YPVYSCPNVDD--DCVTFEPPAGPATQFSSCQKNVLGEGNANRLCQKHSSP 365
              |..||       .|.|:  .:||  |.:.                 .|..||...|       
Human   190 --DKKGPAAIQKNYSPYYN--TIDDLKDQIV-----------------DLTVGNNKTL------- 226

  Fly   366 RLRQMHISNTRSCVLCGEDVSWLPKVAACPCCGYKPVPEFKERPYDEQATAQQILLD--HLENPV 428
                :.|.|||                       ..:.:|:.:...||...|.:..|  .|...:
Human   227 ----LDIDNTR-----------------------MTLDDFRIKFEMEQNLRQGVDADINGLRQVL 264

  Fly   429 ENLSFDMGSVEGCSANEEHGVPEPTSEAFEAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSA 493
            :||:.:...:|               ..:|.:.::...|:::.:|..::.|...:.:...:...|
Human   265 DNLTMEKSDLE---------------MQYETLQEELMALKKNHKEEMSQLTGQNSGDVNVEINVA 314

  Fly   494 QPQDLAKVFTELRDLFNVKAAD-----ENQ----------------------------------- 518
            ..:||.|...::|..:....|.     |||                                   
Human   315 PGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQE 379

  Fly   519 ---KIQDICAEACALAKSHKKSKNR 540
               ::|...::..||.||.:.:|||
Human   380 LEIELQSQLSKKAALEKSLEDTKNR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 9/48 (19%)
DUF4776 371..848 CDD:292622 33/214 (15%)
KRT9NP_000217.2 Head 1..152 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Filament 152..464 CDD:365827 53/338 (16%)
Coil 1A 153..188 6/42 (14%)
Linker 1 189..207 5/29 (17%)
Coil 1B 208..299 23/156 (15%)
Linker 12 300..322 4/21 (19%)
Coil 2 323..461 12/81 (15%)
Tail 462..623
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..496
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 534..623
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.