DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and Krt19

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_955792.1 Gene:Krt19 / 360626 RGDID:619936 Length:403 Species:Rattus norvegicus


Alignment Length:334 Identity:61/334 - (18%)
Similarity:106/334 - (31%) Gaps:127/334 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DGRLAGGQERGCFPNMNVDLQDLSFMSTSSIDPCVGFMPSDTEVAQDSPPCSEDRAQDSFQCQDS 306
            || |.||.|:       :.:|:|:....|.:|.......::.|:        |.:.:|.:|.|. 
  Rat    76 DG-LLGGNEK-------ITMQNLNDRLASYLDKVRALEQANGEL--------EVKIRDWYQKQG- 123

  Fly   307 PPRLIDMAGPYPVYS--CPNVDDDCVTFEPPAGPATQFSSCQKNVLGEGNANRLCQKHSSPRLRQ 369
                   .||:..||  ...::|                 .:..:||....|...         .
  Rat   124 -------PGPFRDYSQYFKTIED-----------------LRDKILGATIENSKI---------V 155

  Fly   370 MHISNTRSCVLCGEDVSWLPKVAACPCCGYKPVPEFKERPYDEQATAQQI---------LLDH-- 423
            :.|.|.|   |..:|                    |:.:...|||....:         :||.  
  Rat   156 LQIDNAR---LAADD--------------------FRTKFETEQALRMSVEADINGLRRVLDELT 197

  Fly   424 -----LENPVENLSFDMGSVEGCSANEEHGVPEPTSEAFEAIVKDYQLLRRSIRESNTKATQSAT 483
                 ||..:|||..::..::     :.|                         |....|.:|..
  Rat   198 LARTDLEMQIENLKEELAYLK-----KNH-------------------------EEEISALRSQV 232

  Fly   484 KNPTAQEGSAQPQ-DLAKVFTELRDLFNVKAADENQKIQDICAEACALAKSHKKSKNRPASPERT 547
            ....:.|..:.|. ||||:.:|:|..:.. .|::|:|    .|||..|.:..:.:........:.
  Rat   233 GGQVSVEVDSTPGIDLAKILSEMRSQYEA-MAEKNRK----DAEAWYLTQIDELNTQVAVHTTQI 292

  Fly   548 KAGKTDPVE 556
            :..||:..|
  Rat   293 QINKTEVTE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 11/51 (22%)
DUF4776 371..848 CDD:292622 38/203 (19%)
Krt19NP_955792.1 Head 1..82 4/6 (67%)
Filament 82..393 CDD:278467 56/327 (17%)
Coil 1A 83..118 7/49 (14%)
Linker 1 119..136 6/24 (25%)
Coil 1B 137..228 22/169 (13%)
Linker 12 229..251 6/21 (29%)
Necessary for interaction with PNN. /evidence=ECO:0000250 247..393 16/60 (27%)
Coil 2 252..390 12/55 (22%)
Rod-like helical tail 391..403
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.