DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and Krt28

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:XP_006247418.1 Gene:Krt28 / 360623 RGDID:1309530 Length:462 Species:Rattus norvegicus


Alignment Length:248 Identity:43/248 - (17%)
Similarity:79/248 - (31%) Gaps:93/248 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 IVQKLNMPGRDFECQ------DKLQIKANVCRGCKI--CLGSSSINV--NCLP-------LN--- 152
            ::.:|.:...|.|.|      :...:|.|.....|:  |....::||  |..|       ||   
  Rat   197 VLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKVLQCAAGGNVNVEMNAAPGVDLTVLLNNMR 261

  Fly   153 -------------PDKTFQMEAECLQRQLAEGINIS------VVYLRKEI--------------- 183
                         .:..||.::..||:|::..:..:      :..|::.:               
  Rat   262 AEYEALAEQNRRDAEAWFQEKSATLQQQISNDLGAATSARTELTELKRSLQTLEIELQSLSATKH 326

  Fly   184 --------ARGCYFPPAAVVSRMINDFDEIVHDANVELTCKGCTVG-------IMNIRFAMQMRC 233
                    ..|.|....|.:...|:..:|.:|....|      |.|       :::|:..::...
  Rat   327 SLECTLAETEGNYCSQLAQIQAQISALEEQLHQVRTE------TEGQKLEHEQLLDIKAHLEKEI 385

  Fly   234 QTLKEDAVDGRLAGGQERGCFP----------NMNVDLQDLSFMST--SSIDP 274
            :|.      .||.||.|..|..          |.:.|:...:.:.|  ..|||
  Rat   386 ETY------CRLIGGDENSCSSSKGFESGTSGNSSKDVSKTTLVKTVVEEIDP 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 43/248 (17%)
DUF4776 371..848 CDD:292622
Krt28XP_006247418.1 Filament 83..397 CDD:278467 35/211 (17%)
SPEC 178..372 CDD:295325 29/180 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.