| Sequence 1: | NP_733345.2 | Gene: | Ppi1 / 43581 | FlyBaseID: | FBgn0051025 | Length: | 998 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_853515.2 | Gene: | KRT27 / 342574 | HGNCID: | 30841 | Length: | 459 | Species: | Homo sapiens |
| Alignment Length: | 237 | Identity: | 45/237 - (18%) |
|---|---|---|---|
| Similarity: | 77/237 - (32%) | Gaps: | 68/237 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 343 SSC-----QKNVLGEGNANRLCQKHSSPRLRQMHISNTRSCVLCGEDV-----SWLPKVAACPCC 397
Fly 398 G-------YKP-VPEFKERPYDEQATAQQILLDH-----------------------LENPVENL 431
Fly 432 SFDMGSVEGCSANEEHGVPEPTSEAFEAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQP- 495
Fly 496 QDLAKVFTELR---------------DLFNVKAADENQKIQD 522 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ppi1 | NP_733345.2 | DUF4788 | 108..>294 | CDD:292651 | |
| DUF4776 | 371..848 | CDD:292622 | 38/204 (19%) | ||
| KRT27 | NP_853515.2 | Head. /evidence=ECO:0000255 | 1..83 | 3/15 (20%) | |
| Filament | 83..396 | CDD:278467 | 41/221 (19%) | ||
| Coil 1A. /evidence=ECO:0000255 | 84..119 | 5/35 (14%) | |||
| Linker 1. /evidence=ECO:0000255 | 120..141 | 4/20 (20%) | |||
| Coil 1B. /evidence=ECO:0000255 | 142..233 | 13/99 (13%) | |||
| SPEC | 178..375 | CDD:295325 | 26/124 (21%) | ||
| Linker 12. /evidence=ECO:0000255 | 234..256 | 7/21 (33%) | |||
| Coil 2. /evidence=ECO:0000255 | 257..395 | 8/36 (22%) | |||
| Tail. /evidence=ECO:0000255 | 396..459 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 436..459 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_28M49 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||