DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and cyt1

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_571182.1 Gene:cyt1 / 30327 ZFINID:ZDB-GENE-991008-6 Length:429 Species:Danio rerio


Alignment Length:99 Identity:21/99 - (21%)
Similarity:46/99 - (46%) Gaps:5/99 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 EAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQPQDLAKVFTELRDLFNVKAADENQKIQD 522
            |.:.::...|:::..|....|....:.....:..:|..:||.|:..::|:.:...:| :|:|  |
Zfish   207 EGLKEELIFLKKNHEEELLAARTQMSGQVNVEVDAAPQEDLTKILADIREHYEAVSA-KNRK--D 268

  Fly   523 ICAEACALAKSHKKSKNRPASPERTKAGKTDPVE 556
            :  |:...|||...:|....|.|..:..:::..|
Zfish   269 L--ESWFQAKSESLNKEVAVSTETLQTSRSEITE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651
DUF4776 371..848 CDD:292622 21/99 (21%)
cyt1NP_571182.1 Filament 81..389 CDD:278467 21/99 (21%)
Wzz <234..383 CDD:302979 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.