DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and Krt34

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_081839.1 Gene:Krt34 / 16672 MGIID:1309994 Length:392 Species:Mus musculus


Alignment Length:187 Identity:39/187 - (20%)
Similarity:62/187 - (33%) Gaps:54/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKYECKPEP-VEKKEKPVEELMNWDAYYKNRGLVST--RLGSCKADYM---------------- 46
            :.:..|:.|. ||...:.|||.....:...|:.:||:  :|.||:|:.:                
Mouse   225 LNETRCQYEALVETNRREVEEWFTTQSEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQ 289

  Fly    47 HCSTYQEKGNAQEKDKKGKGACCCSSCPVRNREEVYQPRCPAPGQKGKPNRDYMRCFAAKLIVQK 111
            ||.....:....|.:.:.........|.:.|.|          .|.|:...|..|          
Mouse   290 HCMRNSLENTLTESEARYSSQLSQVQCLITNVE----------SQLGEIRADLER---------- 334

  Fly   112 LNMPGRDFECQDKLQIKANVCRGCKI-----CLGSSSINVNCLPLNPDKTFQMEAEC 163
                 ::.|.|..|.::|.:  .|:|     .|.|...|   ||.||..|......|
Mouse   335 -----QNQEYQVLLDVRARL--ECEINTYRSLLESEDCN---LPCNPCATTNASGSC 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 15/61 (25%)
DUF4776 371..848 CDD:292622
Krt34NP_081839.1 Head 1..56
Filament 55..366 CDD:278467 32/167 (19%)
Coil 1A 57..91
Linker 1 92..102
Coil 1B 103..203
Linker 12 204..219
Coil 2 220..363 31/164 (19%)
Tail 364..392 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.